Diaphorina citri psyllid: psy7981

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MAESAVQQQAQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
ccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHcHHHHHHHccccEEEEcccccccHHHHHHHHHHHcccccccEEEECccccccccccHHHHHHccccccccccccccHHHHHHcccccccccccHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHcccEEEEcccccccHHHHHHcccc
************LSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESAVQQQAQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Bifunctional protein FolD Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate.confidentC3LJV5
Bifunctional protein FolD Catalyzes the oxidation of 5,10-methylenetetrahydrofolate to 5,10-methenyltetrahydrofolate and then the hydrolysis of 5,10-methenyltetrahydrofolate to 10-formyltetrahydrofolate.confidentQ5HH21
C-1-tetrahydrofolate synthase, cytoplasmic confidentQ922D8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005488 [MF]bindingprobableGO:0003674
GO:0046653 [BP]tetrahydrofolate metabolic processprobableGO:0006732, GO:0019752, GO:0006807, GO:0044281, GO:1901360, GO:0044710, GO:0051186, GO:0006520, GO:0042558, GO:0071704, GO:1901605, GO:0006760, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:0044237
GO:0003824 [MF]catalytic activityprobableGO:0003674
GO:0034641 [BP]cellular nitrogen compound metabolic processprobableGO:0009987, GO:0006807, GO:0008150, GO:0008152, GO:0044237
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0009507 [CC]chloroplastprobableGO:0005737, GO:0009536, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046655 [BP]folic acid metabolic processprobableGO:0006732, GO:0019752, GO:0006807, GO:0044281, GO:1901360, GO:0044710, GO:0051186, GO:0006520, GO:0042558, GO:0071704, GO:1901605, GO:0006767, GO:0006766, GO:0006760, GO:0044238, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0043436, GO:0046483, GO:0043648, GO:1901564, GO:0006575, GO:0006082, GO:0044237
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
3.-.-.-Hydrolases.probable
1.5.-.-Acting on the CH-NH group of donors.probable
3.5.-.-Acting on carbon-nitrogen bonds, other than peptide bonds.probable
1.5.1.-5,10-methylenetetrahydromethanopterin reductase.probable
3.5.4.-4'-demethylrebeccamycin synthase.probable
3.5.4.9Methenyltetrahydrofolate cyclohydrolase.probable
1.5.1.5Methylenetetrahydrofolate dehydrogenase (NADP(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A26, chain A
Confidence level:very confident
Coverage over the Query: 9-214
View the alignment between query and template
View the model in PyMOL