Psyllid ID: psy7981

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210------
MAESAVQQQAQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
ccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHcHHHHHHHccccEEEEcccccccHHHHHHHHHHHcccccccEEEEEccccccccccHHHHHHccccccccccccccHHHHHHcccccccccccHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHcccEEEEcccccccHHHHHHcccc
ccccccccccEEccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHHHHccEEEEEEEcccccHHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHHcccHHHEcccccHHHHHHHHcccccccccHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHcccEEEEEccccccHHHHHHHccc
MAESAVQQQAQILSGTAVSGDIREGLKERVKKLKErlpdfepglaIVQVGGREDSNVYIRMKMKAAKEigidaqhvklprSITEIELLSRLKklnedpsvhgiivqmpldsdndinamlvtdsvspekdvdglntinegrvaigdmngfipctpngVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHsktkniqdvvkspml
maesavqqqaqilsgtavsgdiREGLKERVKKLkerlpdfepglaivqvggredsNVYIRMKMKAAKeigidaqhvklprSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDsvspekdvdglNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVtvchsktkniqdvvkspml
MAESAVQQQAQILSGTAVSGDIreglkervkklkerlPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
**************************************DFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTD******DVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTK***********
************LSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
**********QILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
********QAQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAESAVQQQAQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSPML
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query216 2.2.26 [Sep-21-2011]
O96553 968 C-1-tetrahydrofolate synt yes N/A 0.981 0.219 0.685 3e-82
Q27772 933 C-1-tetrahydrofolate synt N/A N/A 0.888 0.205 0.666 7e-73
P11586 935 C-1-tetrahydrofolate synt yes N/A 0.935 0.216 0.586 3e-64
Q922D8 935 C-1-tetrahydrofolate synt yes N/A 0.916 0.211 0.592 9e-64
Q5R8P0 935 C-1-tetrahydrofolate synt yes N/A 0.935 0.216 0.581 1e-63
P27653 935 C-1-tetrahydrofolate synt yes N/A 0.916 0.211 0.592 2e-63
Q8WZJ7 937 C-1-tetrahydrofolate synt yes N/A 0.935 0.215 0.478 2e-50
O43007 972 C-1-tetrahydrofolate synt no N/A 0.921 0.204 0.490 8e-49
P09440 975 C-1-tetrahydrofolate synt yes N/A 0.930 0.206 0.465 2e-47
P07245 946 C-1-tetrahydrofolate synt no N/A 0.898 0.205 0.477 9e-46
>sp|O96553|C1TC_DROME C-1-tetrahydrofolate synthase, cytoplasmic OS=Drosophila melanogaster GN=pug PE=1 SV=4 Back     alignment and function desciption
 Score =  304 bits (779), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 146/213 (68%), Positives = 178/213 (83%), Gaps = 1/213 (0%)

Query: 2   AESAVQQQ-AQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIR 60
           AE A++   A+I+SGTAV+  IRE L+  V  + ++L DF PGL IVQVGGREDSNVYIR
Sbjct: 29  AEPAIKMSGAKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIR 88

Query: 61  MKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLV 120
           MK+KAA EIGIDA HV+LPRSITE+ELL ++  LNEDP VHGIIVQMPLD D  I++  +
Sbjct: 89  MKIKAATEIGIDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRI 148

Query: 121 TDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSK 180
           TD+VSPEKDVDGL+T+NEGR+AIGD+ GF+PCTP G LELI+R+ V IAG  AVVLGRSK
Sbjct: 149 TDAVSPEKDVDGLHTVNEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSK 208

Query: 181 IVGTPAAELLKWKHATVTVCHSKTKNIQDVVKS 213
           IVGTPAAELLKW +ATVTVCHSKT+N++++ +S
Sbjct: 209 IVGTPAAELLKWANATVTVCHSKTRNLEEITRS 241

Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 4EC: .EC: 3
>sp|Q27772|C1TC_SPOFR C-1-tetrahydrofolate synthase, cytoplasmic OS=Spodoptera frugiperda PE=2 SV=3 Back     alignment and function description
>sp|P11586|C1TC_HUMAN C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens GN=MTHFD1 PE=1 SV=3 Back     alignment and function description
>sp|Q922D8|C1TC_MOUSE C-1-tetrahydrofolate synthase, cytoplasmic OS=Mus musculus GN=Mthfd1 PE=1 SV=4 Back     alignment and function description
>sp|Q5R8P0|C1TC_PONAB C-1-tetrahydrofolate synthase, cytoplasmic OS=Pongo abelii GN=MTHFD1 PE=2 SV=3 Back     alignment and function description
>sp|P27653|C1TC_RAT C-1-tetrahydrofolate synthase, cytoplasmic OS=Rattus norvegicus GN=Mthfd1 PE=1 SV=3 Back     alignment and function description
>sp|Q8WZJ7|C1TC_SCHPO C-1-tetrahydrofolate synthase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC839.16 PE=3 SV=1 Back     alignment and function description
>sp|O43007|C1TM_SCHPO C-1-tetrahydrofolate synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ade9 PE=3 SV=3 Back     alignment and function description
>sp|P09440|C1TM_YEAST C-1-tetrahydrofolate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MIS1 PE=1 SV=1 Back     alignment and function description
>sp|P07245|C1TC_YEAST C-1-tetrahydrofolate synthase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADE3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
322795648 937 hypothetical protein SINV_02960 [Solenop 0.930 0.214 0.731 8e-82
383849146 937 PREDICTED: c-1-tetrahydrofolate synthase 0.925 0.213 0.73 5e-81
45551871 968 pugilist, isoform B [Drosophila melanoga 0.981 0.219 0.685 1e-80
195330069 968 GM23891 [Drosophila sechellia] gi|194120 0.981 0.219 0.685 2e-80
386765496 965 pugilist, isoform E [Drosophila melanoga 0.981 0.219 0.685 2e-80
195571961 968 GD18702 [Drosophila simulans] gi|1941998 0.981 0.219 0.685 2e-80
385719252 958 RH19138p1 [Drosophila melanogaster] 0.981 0.221 0.685 2e-80
195499820 968 GE26043 [Drosophila yakuba] gi|194183210 0.981 0.219 0.685 4e-80
60677839 934 RE42943p [Drosophila melanogaster] 0.944 0.218 0.700 5e-80
17137370 934 pugilist, isoform A [Drosophila melanoga 0.944 0.218 0.700 5e-80
>gi|322795648|gb|EFZ18327.1| hypothetical protein SINV_02960 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  308 bits (790), Expect = 8e-82,   Method: Compositional matrix adjust.
 Identities = 147/201 (73%), Positives = 172/201 (85%)

Query: 12  ILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGI 71
           +LSGT ++ +IR+GL   V  LKE+LPDF PGLAIVQVG REDSNVYI+MK+ AA+EIGI
Sbjct: 9   VLSGTELAKEIRQGLIRDVSVLKEKLPDFAPGLAIVQVGAREDSNVYIKMKINAAREIGI 68

Query: 72  DAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVD 131
           D Q  +LP + TEIEL++++ KLN DP+VHGIIVQMPLDS N IN+ L+TD VSPEKDVD
Sbjct: 69  DVQRCQLPNTTTEIELINKVSKLNNDPNVHGIIVQMPLDSVNKINSHLITDLVSPEKDVD 128

Query: 132 GLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLK 191
           GLNTINEGR AIGDM+GF+PCTPNG +ELIKR+ VTIAG  AVVLGRSKIVGTP AELLK
Sbjct: 129 GLNTINEGRTAIGDMSGFVPCTPNGCIELIKRSGVTIAGAQAVVLGRSKIVGTPVAELLK 188

Query: 192 WKHATVTVCHSKTKNIQDVVK 212
           W +ATVTVCHSKTKN+ DVV+
Sbjct: 189 WNNATVTVCHSKTKNLPDVVR 209

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383849146|ref|XP_003700207.1| PREDICTED: c-1-tetrahydrofolate synthase, cytoplasmic-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|45551871|ref|NP_731489.2| pugilist, isoform B [Drosophila melanogaster] gi|62472483|ref|NP_001014614.1| pugilist, isoform D [Drosophila melanogaster] gi|50403703|sp|O96553.4|C1TC_DROME RecName: Full=C-1-tetrahydrofolate synthase, cytoplasmic; Short=C1-THF synthase; Includes: RecName: Full=Methylenetetrahydrofolate dehydrogenase; Includes: RecName: Full=Methenyltetrahydrofolate cyclohydrolase; Includes: RecName: Full=Formyltetrahydrofolate synthetase gi|45446446|gb|AAG22140.2| pugilist, isoform B [Drosophila melanogaster] gi|61679325|gb|AAX52944.1| pugilist, isoform D [Drosophila melanogaster] gi|323301174|gb|ADX35929.1| LD23514p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195330069|ref|XP_002031731.1| GM23891 [Drosophila sechellia] gi|194120674|gb|EDW42717.1| GM23891 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|386765496|ref|NP_001247028.1| pugilist, isoform E [Drosophila melanogaster] gi|383292620|gb|AFH06346.1| pugilist, isoform E [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195571961|ref|XP_002103969.1| GD18702 [Drosophila simulans] gi|194199896|gb|EDX13472.1| GD18702 [Drosophila simulans] Back     alignment and taxonomy information
>gi|385719252|gb|AFI71924.1| RH19138p1 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195499820|ref|XP_002097109.1| GE26043 [Drosophila yakuba] gi|194183210|gb|EDW96821.1| GE26043 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|60677839|gb|AAX33426.1| RE42943p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|17137370|ref|NP_477254.1| pugilist, isoform A [Drosophila melanogaster] gi|24645718|ref|NP_731490.1| pugilist, isoform C [Drosophila melanogaster] gi|3916246|gb|AAC78847.1| C1-THF synthase homolog [Drosophila melanogaster] gi|23170927|gb|AAN13478.1| pugilist, isoform A [Drosophila melanogaster] gi|23170928|gb|AAN13479.1| pugilist, isoform C [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query216
FB|FBgn0020385 968 pug "pugilist" [Drosophila mel 0.981 0.219 0.661 4.8e-71
UNIPROTKB|A4FUD0 935 MTHFD1 "MTHFD1 protein" [Bos t 0.958 0.221 0.564 1.2e-56
UNIPROTKB|F1NMC3 935 MTHFD1 "Uncharacterized protei 0.958 0.221 0.531 1.9e-55
UNIPROTKB|P11586 935 MTHFD1 "C-1-tetrahydrofolate s 0.958 0.221 0.545 1.1e-54
UNIPROTKB|E2R2W7 935 MTHFD1 "Uncharacterized protei 0.958 0.221 0.555 1.4e-54
UNIPROTKB|F6XNH4 974 MTHFD1 "Uncharacterized protei 0.958 0.212 0.555 1.8e-54
MGI|MGI:1342005 935 Mthfd1 "methylenetetrahydrofol 0.958 0.221 0.555 1.8e-54
UNIPROTKB|F1PYV1 983 MTHFD1 "Uncharacterized protei 0.958 0.210 0.555 1.8e-54
UNIPROTKB|G3V2B8 935 MTHFD1 "C-1-tetrahydrofolate s 0.958 0.221 0.540 2.4e-54
RGD|708531 935 Mthfd1 "methylenetetrahydrofol 0.958 0.221 0.555 2.4e-54
FB|FBgn0020385 pug "pugilist" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 719 (258.2 bits), Expect = 4.8e-71, P = 4.8e-71
 Identities = 141/213 (66%), Positives = 169/213 (79%)

Query:     2 AESAVQQQ-AQILSGTAVSGDIXXXXXXXXXXXXXXXPDFEPGLAIVQVGGREDSNVYIR 60
             AE A++   A+I+SGTAV+  I                DF PGL IVQVGGREDSNVYIR
Sbjct:    29 AEPAIKMSGAKIISGTAVAKSIREELRNEVTAMSKQLADFVPGLRIVQVGGREDSNVYIR 88

Query:    61 MKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLV 120
             MK+KAA EIGIDA HV+LPRSITE+ELL ++  LNEDP VHGIIVQMPLD D  I++  +
Sbjct:    89 MKIKAATEIGIDAAHVQLPRSITEVELLDKINDLNEDPRVHGIIVQMPLDCDTPIDSHRI 148

Query:   121 TDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSK 180
             TD+VSPEKDVDGL+T+NEGR+AIGD+ GF+PCTP G LELI+R+ V IAG  AVVLGRSK
Sbjct:   149 TDAVSPEKDVDGLHTVNEGRLAIGDLGGFLPCTPWGCLELIRRSGVEIAGARAVVLGRSK 208

Query:   181 IVGTPAAELLKWKHATVTVCHSKTKNIQDVVKS 213
             IVGTPAAELLKW +ATVTVCHSKT+N++++ +S
Sbjct:   209 IVGTPAAELLKWANATVTVCHSKTRNLEEITRS 241
GO:0004488 "methylenetetrahydrofolate dehydrogenase (NADP+) activity" evidence=ISS;IBA
GO:0004477 "methenyltetrahydrofolate cyclohydrolase activity" evidence=ISS;IBA
GO:0004329 "formate-tetrahydrofolate ligase activity" evidence=ISS;IBA
GO:0005737 "cytoplasm" evidence=IDA
GO:0009396 "folic acid-containing compound biosynthetic process" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
GO:0006730 "one-carbon metabolic process" evidence=IBA
GO:0005829 "cytosol" evidence=IBA
UNIPROTKB|A4FUD0 MTHFD1 "MTHFD1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NMC3 MTHFD1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P11586 MTHFD1 "C-1-tetrahydrofolate synthase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2R2W7 MTHFD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XNH4 MTHFD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1342005 Mthfd1 "methylenetetrahydrofolate dehydrogenase (NADP+ dependent), methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PYV1 MTHFD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G3V2B8 MTHFD1 "C-1-tetrahydrofolate synthase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|708531 Mthfd1 "methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
C3LJV5FOLD_BACAC3, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
B7JM32FOLD_BACC03, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
Q922D8C1TC_MOUSE6, ., 3, ., 4, ., 30.59290.91660.2117yesN/A
Q3ZX43FOLD_DEHSC3, ., 5, ., 4, ., 90.41340.92590.6756yesN/A
B8I761FOLD_CLOCE3, ., 5, ., 4, ., 90.43900.92590.7042yesN/A
C1ERQ4FOLD_BACC33, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
Q5HH21FOLD_STAAC3, ., 5, ., 4, ., 90.42360.91660.6923yesN/A
Q7A697FOLD_STAAN3, ., 5, ., 4, ., 90.41870.91660.6923yesN/A
B1YLQ1FOLD_EXIS23, ., 5, ., 4, ., 90.44440.89350.6967yesN/A
Q5R8P0C1TC_PONAB6, ., 3, ., 4, ., 30.58120.93510.2160yesN/A
A8Z1K5FOLD_STAAT3, ., 5, ., 4, ., 90.42360.91660.6923yesN/A
A6U0N1FOLD_STAA23, ., 5, ., 4, ., 90.41870.91660.6923yesN/A
A0RIH3FOLD_BACAH3, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
A6QFS2FOLD_STAAE3, ., 5, ., 4, ., 90.42360.91660.6923yesN/A
C4ZBG7FOLD_EUBR33, ., 5, ., 4, ., 90.43620.92120.7132yesN/A
Q2YX11FOLD_STAAB3, ., 5, ., 4, ., 90.41870.91660.6923yesN/A
B7GHF9FOLD_ANOFW3, ., 5, ., 4, ., 90.41870.91660.6996yesN/A
C0ZC05FOLD_BREBN3, ., 5, ., 4, ., 90.440.90270.6866yesN/A
B9M769FOLD_GEOSF3, ., 5, ., 4, ., 90.45950.89350.6892yesN/A
A5IRV0FOLD_STAA93, ., 5, ., 4, ., 90.41870.91660.6923yesN/A
Q99V34FOLD_STAAM3, ., 5, ., 4, ., 90.41870.91660.6923yesN/A
P11586C1TC_HUMAN6, ., 3, ., 4, ., 30.58620.93510.2160yesN/A
A7ZCH3FOLD_CAMC13, ., 5, ., 4, ., 90.45810.91660.6996yesN/A
Q39WH4FOLD2_GEOMG3, ., 5, ., 4, ., 90.43340.91660.6947yesN/A
Q6HDY4FOLD_BACHK3, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
P54382FOLD_BACSU3, ., 5, ., 4, ., 90.41870.91660.6996yesN/A
Q75TC1FOLD_GEOKA3, ., 5, ., 4, ., 90.42360.91660.6971yesN/A
Q6GAF0FOLD_STAAS3, ., 5, ., 4, ., 90.42360.91660.6923yesN/A
A7X0V3FOLD_STAA13, ., 5, ., 4, ., 90.41870.91660.6923yesN/A
A7GSJ9FOLD_BACCN3, ., 5, ., 4, ., 90.45320.91660.6923yesN/A
Q9K966FOLD_BACHD3, ., 5, ., 4, ., 90.47290.91660.7096yesN/A
Q8NX95FOLD_STAAW3, ., 5, ., 4, ., 90.42360.91660.6923yesN/A
P27653C1TC_RAT6, ., 3, ., 4, ., 30.59290.91660.2117yesN/A
C3P7W0FOLD_BACAA3, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
O96553C1TC_DROME6, ., 3, ., 4, ., 30.68540.98140.2190yesN/A
Q2FZJ6FOLD_STAA83, ., 5, ., 4, ., 90.42360.91660.6923yesN/A
Q81M50FOLD_BACAN3, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
A4IQS0FOLD_GEOTN3, ., 5, ., 4, ., 90.44820.91660.6971yesN/A
Q635A3FOLD_BACCZ3, ., 5, ., 4, ., 90.42850.91660.6923yesN/A
Q6GI21FOLD_STAAR3, ., 5, ., 4, ., 90.41870.91660.6923yesN/A
Q2RIB4FOLD_MOOTA3, ., 5, ., 4, ., 90.43430.89350.6892yesN/A
A1TPZ6FOLD_ACIAC3, ., 5, ., 4, ., 90.44220.89810.6855yesN/A
A9VGW3FOLD_BACWK3, ., 5, ., 4, ., 90.44330.91660.6923yesN/A
C0R2N7FOLD_WOLWR3, ., 5, ., 4, ., 90.44440.90270.6678yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.4.90.824
3rd Layer3.5.40.766
3rd Layer1.5.10.766
4th Layer1.5.1.50.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
COG0190283 COG0190, FolD, 5,10-methylene-tetrahydrofolate deh 9e-76
PRK14190284 PRK14190, PRK14190, bifunctional 5,10-methylene-te 7e-68
PRK14189285 PRK14189, PRK14189, bifunctional 5,10-methylene-te 2e-58
PRK14188296 PRK14188, PRK14188, bifunctional 5,10-methylene-te 5e-58
PRK14172278 PRK14172, PRK14172, bifunctional 5,10-methylene-te 6e-57
PRK10792285 PRK10792, PRK10792, bifunctional 5,10-methylene-te 1e-56
PLN02516299 PLN02516, PLN02516, methylenetetrahydrofolate dehy 7e-56
PRK14191285 PRK14191, PRK14191, bifunctional 5,10-methylene-te 2e-54
PLN02616364 PLN02616, PLN02616, tetrahydrofolate dehydrogenase 2e-53
PRK14184286 PRK14184, PRK14184, bifunctional 5,10-methylene-te 4e-53
PLN02897345 PLN02897, PLN02897, tetrahydrofolate dehydrogenase 9e-53
PRK14179284 PRK14179, PRK14179, bifunctional 5,10-methylene-te 5e-52
PRK14174295 PRK14174, PRK14174, bifunctional 5,10-methylene-te 2e-51
PRK14175286 PRK14175, PRK14175, bifunctional 5,10-methylene-te 4e-50
PRK14181287 PRK14181, PRK14181, bifunctional 5,10-methylene-te 1e-49
PRK14187294 PRK14187, PRK14187, bifunctional 5,10-methylene-te 4e-49
PRK14193284 PRK14193, PRK14193, bifunctional 5,10-methylene-te 6e-49
PRK14192283 PRK14192, PRK14192, bifunctional 5,10-methylene-te 9e-48
pfam00763117 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydroge 2e-47
PRK14185293 PRK14185, PRK14185, bifunctional 5,10-methylene-te 4e-47
PRK14170284 PRK14170, PRK14170, bifunctional 5,10-methylene-te 4e-46
PRK14183281 PRK14183, PRK14183, bifunctional 5,10-methylene-te 1e-45
PRK14173287 PRK14173, PRK14173, bifunctional 5,10-methylene-te 2e-45
PRK14171288 PRK14171, PRK14171, bifunctional 5,10-methylene-te 2e-45
PRK14176287 PRK14176, PRK14176, bifunctional 5,10-methylene-te 5e-45
PRK14178279 PRK14178, PRK14178, bifunctional 5,10-methylene-te 1e-44
PRK14167297 PRK14167, PRK14167, bifunctional 5,10-methylene-te 2e-44
PRK14186297 PRK14186, PRK14186, bifunctional 5,10-methylene-te 7e-44
PRK14177284 PRK14177, PRK14177, bifunctional 5,10-methylene-te 9e-44
PRK14169282 PRK14169, PRK14169, bifunctional 5,10-methylene-te 4e-43
PRK14168297 PRK14168, PRK14168, bifunctional 5,10-methylene-te 2e-42
PRK14166282 PRK14166, PRK14166, bifunctional 5,10-methylene-te 3e-42
PRK14194301 PRK14194, PRK14194, bifunctional 5,10-methylene-te 7e-42
PRK14182282 PRK14182, PRK14182, bifunctional 5,10-methylene-te 1e-41
PRK14180282 PRK14180, PRK14180, bifunctional 5,10-methylene-te 8e-39
cd01080168 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding 4e-38
pfam02882160 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydro 6e-32
cd05212140 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) b 1e-11
>gnl|CDD|223268 COG0190, FolD, 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information 
 Score =  229 bits (586), Expect = 9e-76
 Identities = 94/202 (46%), Positives = 134/202 (66%), Gaps = 4/202 (1%)

Query: 11  QILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIG 70
            I+ G A++  IRE LKE+V+ LK +   F+PGLA++ VG    S VY+R K KAA+EIG
Sbjct: 1   MIIDGKALAEKIREELKEKVEALKAK-GGFKPGLAVILVGDDPASQVYVRSKKKAAEEIG 59

Query: 71  IDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDV 130
           I ++   LP  ITE ELL+ + +LN DP V GI+VQ+PL     ++   +  ++ PEKDV
Sbjct: 60  IASELYDLPEDITEEELLALIDELNADPEVDGILVQLPL--PKHLDEQKLLQAIDPEKDV 117

Query: 131 DGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELL 190
           DG +  N G++A G+  GF+PCTP G++ L++   + + G N VV+GRS IVG P A LL
Sbjct: 118 DGFHPYNLGKLAQGE-PGFLPCTPAGIMTLLEEYGIDLRGKNVVVVGRSNIVGKPLALLL 176

Query: 191 KWKHATVTVCHSKTKNIQDVVK 212
              +ATVTVCHS+TK++  + K
Sbjct: 177 LNANATVTVCHSRTKDLASITK 198

Length = 283
>gnl|CDD|184560 PRK14190, PRK14190, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184559 PRK14189, PRK14189, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184558 PRK14188, PRK14188, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172660 PRK14172, PRK14172, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|236760 PRK10792, PRK10792, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|178131 PLN02516, PLN02516, methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>gnl|CDD|172679 PRK14191, PRK14191, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|215332 PLN02616, PLN02616, tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>gnl|CDD|237635 PRK14184, PRK14184, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|178485 PLN02897, PLN02897, tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>gnl|CDD|237634 PRK14179, PRK14179, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172662 PRK14174, PRK14174, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184552 PRK14175, PRK14175, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172669 PRK14181, PRK14181, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172675 PRK14187, PRK14187, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237637 PRK14193, PRK14193, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184561 PRK14192, PRK14192, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|201431 pfam00763, THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain Back     alignment and domain information
>gnl|CDD|184556 PRK14185, PRK14185, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172658 PRK14170, PRK14170, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184555 PRK14183, PRK14183, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184551 PRK14173, PRK14173, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172659 PRK14171, PRK14171, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172666 PRK14178, PRK14178, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184549 PRK14167, PRK14167, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237636 PRK14186, PRK14186, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172665 PRK14177, PRK14177, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|184550 PRK14169, PRK14169, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|237633 PRK14168, PRK14168, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172654 PRK14166, PRK14166, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172682 PRK14194, PRK14194, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172670 PRK14182, PRK14182, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|172668 PRK14180, PRK14180, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>gnl|CDD|133448 cd01080, NAD_bind_m-THF_DH_Cyclohyd, NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>gnl|CDD|217267 pfam02882, THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain Back     alignment and domain information
>gnl|CDD|133451 cd05212, NAD_bind_m-THF_DH_Cyclohyd_like, NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 216
PRK14171288 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14170284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PLN02516299 methylenetetrahydrofolate dehydrogenase (NADP+) 100.0
PRK14187294 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PLN02616364 tetrahydrofolate dehydrogenase/cyclohydrolase, put 100.0
COG0190283 FolD 5,10-methylene-tetrahydrofolate dehydrogenase 100.0
PRK14169282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PLN02897345 tetrahydrofolate dehydrogenase/cyclohydrolase, put 100.0
PRK14190284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14172278 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14166282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14177284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14182282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14193284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14167297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14173287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14176287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14168297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14186297 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14185293 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14183281 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14181287 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK10792285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14180282 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14184286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14189285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14191285 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14175286 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14179284 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14174295 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14194301 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14178279 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
PRK14188296 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
KOG4230|consensus 935 100.0
PRK14192283 bifunctional 5,10-methylene-tetrahydrofolate dehyd 100.0
KOG0089|consensus309 100.0
PF00763117 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cycloh 100.0
cd01079197 NAD_bind_m-THF_DH NAD binding domain of methylene- 100.0
PF02882160 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cycl 99.96
cd05212140 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding dom 99.87
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 99.82
PRK00258 278 aroE shikimate 5-dehydrogenase; Reviewed 97.69
TIGR00507 270 aroE shikimate 5-dehydrogenase. This model finds p 97.65
cd0519186 NAD_bind_amino_acid_DH NAD(P) binding domain of am 97.53
PRK12549 284 shikimate 5-dehydrogenase; Reviewed 97.44
TIGR01809 282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 97.4
PRK12548 289 shikimate 5-dehydrogenase; Provisional 97.35
cd01075 200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 97.32
PRK12550 272 shikimate 5-dehydrogenase; Reviewed 97.32
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 97.11
PTZ00075 476 Adenosylhomocysteinase; Provisional 97.06
PRK12749 288 quinate/shikimate dehydrogenase; Reviewed 97.05
PRK08306296 dipicolinate synthase subunit A; Reviewed 96.82
PRK14027 283 quinate/shikimate dehydrogenase; Provisional 96.7
PRK14804 311 ornithine carbamoyltransferase; Provisional 96.49
PRK14805 302 ornithine carbamoyltransferase; Provisional 96.49
PRK14031 444 glutamate dehydrogenase; Provisional 96.43
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 96.39
PLN02520 529 bifunctional 3-dehydroquinate dehydratase/shikimat 96.28
COG0169 283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 96.03
TIGR00670 301 asp_carb_tr aspartate carbamoyltransferase. Ornith 95.69
cd01078 194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.68
PLN02342 348 ornithine carbamoyltransferase 95.61
cd05313 254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.55
PRK01713 334 ornithine carbamoyltransferase; Provisional 95.32
PRK12562 334 ornithine carbamoyltransferase subunit F; Provisio 95.32
PRK02255 338 putrescine carbamoyltransferase; Provisional 95.31
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 95.29
cd01076 227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 95.17
PRK05476 425 S-adenosyl-L-homocysteine hydrolase; Provisional 95.01
TIGR00658 304 orni_carb_tr ornithine carbamoyltransferase. Most 94.92
PRK03515 336 ornithine carbamoyltransferase subunit I; Provisio 94.92
PRK00856 305 pyrB aspartate carbamoyltransferase catalytic subu 94.82
PRK09414 445 glutamate dehydrogenase; Provisional 94.75
PRK10727 343 DNA-binding transcriptional regulator GalR; Provis 94.66
PRK07200 395 aspartate/ornithine carbamoyltransferase family pr 94.53
PRK10423327 transcriptional repressor RbsR; Provisional 94.52
PRK00779 304 ornithine carbamoyltransferase; Provisional 94.5
PRK14030 445 glutamate dehydrogenase; Provisional 94.5
PRK09526 342 lacI lac repressor; Reviewed 94.41
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 94.32
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 94.28
PRK06719157 precorrin-2 dehydrogenase; Validated 94.23
PLN02527 306 aspartate carbamoyltransferase 94.21
PRK02102 331 ornithine carbamoyltransferase; Validated 94.2
PRK05579 399 bifunctional phosphopantothenoylcysteine decarboxy 94.17
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 94.15
cd05211 217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 94.06
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 94.0
TIGR03316 357 ygeW probable carbamoyltransferase YgeW. Members o 93.98
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 93.79
PRK11891 429 aspartate carbamoyltransferase; Provisional 93.74
TIGR00936 406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 93.67
PLN02477 410 glutamate dehydrogenase 93.63
PRK04284 332 ornithine carbamoyltransferase; Provisional 93.62
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 93.6
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 93.39
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 93.28
PRK13814 310 pyrB aspartate carbamoyltransferase catalytic subu 93.25
PTZ00079 454 NADP-specific glutamate dehydrogenase; Provisional 92.98
PRK10014 342 DNA-binding transcriptional repressor MalI; Provis 92.76
PRK00257 381 erythronate-4-phosphate dehydrogenase; Validated 92.76
cd00401 413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 92.7
cd05311 226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 92.62
COG0334 411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 92.61
PRK10703 341 DNA-binding transcriptional repressor PurR; Provis 92.54
PRK06196 315 oxidoreductase; Provisional 92.45
PRK10401 346 DNA-binding transcriptional regulator GalS; Provis 91.96
PRK06841 255 short chain dehydrogenase; Provisional 91.82
PRK09492315 treR trehalose repressor; Provisional 91.09
PRK15438 378 erythronate-4-phosphate dehydrogenase PdxB; Provis 91.0
PRK05854 313 short chain dehydrogenase; Provisional 90.96
PRK07424 406 bifunctional sterol desaturase/short chain dehydro 90.71
PRK05866 293 short chain dehydrogenase; Provisional 90.68
PRK08192 338 aspartate carbamoyltransferase; Provisional 90.68
PRK06701 290 short chain dehydrogenase; Provisional 90.55
PRK06720 169 hypothetical protein; Provisional 90.49
TIGR00521 390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 90.46
PF00731150 AIRC: AIR carboxylase; InterPro: IPR000031 Phospho 90.44
PRK06197 306 short chain dehydrogenase; Provisional 90.34
PRK02929 499 L-arabinose isomerase; Provisional 90.26
PLN02253 280 xanthoxin dehydrogenase 90.23
PLN02494 477 adenosylhomocysteinase 89.74
PRK14987331 gluconate operon transcriptional regulator; Provis 89.54
PRK06128 300 oxidoreductase; Provisional 89.48
PRK12480 330 D-lactate dehydrogenase; Provisional 89.46
PRK04523 335 N-acetylornithine carbamoyltransferase; Reviewed 89.32
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 89.07
PRK07985 294 oxidoreductase; Provisional 88.76
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 88.64
COG2072 443 TrkA Predicted flavoprotein involved in K+ transpo 88.52
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 88.48
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 87.54
cd03557 484 L-arabinose_isomerase L-Arabinose isomerase (AI) c 87.35
PLN02928 347 oxidoreductase family protein 87.32
PRK13376 525 pyrB bifunctional aspartate carbamoyltransferase c 87.26
PRK13243 333 glyoxylate reductase; Reviewed 87.11
PRK05562 223 precorrin-2 dehydrogenase; Provisional 87.11
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 87.05
PLN02780 320 ketoreductase/ oxidoreductase 87.02
cd00578 452 L-fuc_L-ara-isomerases L-fucose isomerase (FucIase 87.0
PRK11041 309 DNA-binding transcriptional regulator CytR; Provis 86.81
PRK00676 338 hemA glutamyl-tRNA reductase; Validated 86.67
PRK07831 262 short chain dehydrogenase; Provisional 86.64
PRK12367 245 short chain dehydrogenase; Provisional 86.53
PRK07201 657 short chain dehydrogenase; Provisional 86.07
TIGR02405311 trehalos_R_Ecol trehalose operon repressor, proteo 85.83
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 85.59
COG0281 432 SfcA Malic enzyme [Energy production and conversio 85.54
COG1609333 PurR Transcriptional regulators [Transcription] 85.31
PRK06436 303 glycerate dehydrogenase; Provisional 85.02
COG0499 420 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme me 84.97
PRK06484 520 short chain dehydrogenase; Validated 84.2
PRK12862 763 malic enzyme; Reviewed 84.18
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 84.13
PRK07574 385 formate dehydrogenase; Provisional 83.91
PRK08605 332 D-lactate dehydrogenase; Validated 83.88
PRK07232 752 bifunctional malic enzyme oxidoreductase/phosphotr 83.14
PLN02686 367 cinnamoyl-CoA reductase 82.52
PLN02572 442 UDP-sulfoquinovose synthase 82.35
PRK13940 414 glutamyl-tRNA reductase; Provisional 82.28
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 82.0
TIGR01327 525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 81.98
PRK15469 312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 81.51
PRK11790 409 D-3-phosphoglycerate dehydrogenase; Provisional 81.34
PRK08324 681 short chain dehydrogenase; Validated 80.61
PRK00141 473 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 80.48
COG0078 310 ArgF Ornithine carbamoyltransferase [Amino acid tr 80.28
PRK14982 340 acyl-ACP reductase; Provisional 80.23
PLN02427 386 UDP-apiose/xylose synthase 80.16
>PRK14171 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=4.1e-73  Score=502.94  Aligned_cols=203  Identities=39%  Similarity=0.683  Sum_probs=196.6

Q ss_pred             hhhhcccHHHHHHHHHHHHHHHHHHHhcCCCCCceEEEEEeCCCcchHHHHHHHHHHHHHcCcceEEEeCCCCCCHHHHH
Q psy7981           9 QAQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELL   88 (216)
Q Consensus         9 ~a~il~Gk~vA~~i~~~ik~~v~~l~~~~~~~~P~LaiI~vg~~~as~~Yv~~k~k~a~~~Gi~~~~~~l~~~~~~~el~   88 (216)
                      |+++||||++|++|++++++++++|+++ .|++|+|++|++|+||+|..|+++|+|+|+++||++++++||++++|+|++
T Consensus         1 ~~~il~Gk~iA~~i~~~lk~~v~~l~~~-~g~~P~LaiI~vg~d~as~~Yv~~k~k~a~~~Gi~~~~~~l~~~~~~~~l~   79 (288)
T PRK14171          1 MNNIIDGKALANEILADLKLEIQELKSQ-TNASPKLAIVLVGDNPASIIYVKNKIKNAHKIGIDTLLVNLSTTIHTNDLI   79 (288)
T ss_pred             CCeEeeHHHHHHHHHHHHHHHHHHHHhc-cCCCCeEEEEEeCCCccHHHHHHHHHHHHHHcCCEEEEEECCCCCCHHHHH
Confidence            4689999999999999999999999854 378999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcCCCCccEEEEeCCCCCCCCCCHHHHhhhcCCCCCcccCCccchhHhhcCCCCCcccCCHHHHHHHHHHhCCCC
Q psy7981          89 SRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVTI  168 (216)
Q Consensus        89 ~~I~~lN~D~~V~GIlvqlPL~~P~~id~~~i~~~I~p~KDVDG~~~~n~G~l~~~~~~~~~PcTa~av~~lL~~~~i~l  168 (216)
                      +.|++||+|++|||||||+||  |+|+|++.++++|+|+||||||||.|+|+|+.|+..+|+||||+||++||++|++++
T Consensus        80 ~~I~~LN~D~~V~GIlvqlPL--P~~id~~~i~~~I~p~KDVDGl~~~N~g~l~~g~~~~~~PcTp~av~~lL~~y~i~l  157 (288)
T PRK14171         80 SKINELNLDNEISGIIVQLPL--PSSIDKNKILSAVSPSKDIDGFHPLNVGYLHSGISQGFIPCTALGCLAVIKKYEPNL  157 (288)
T ss_pred             HHHHHHcCCCCCCEEEEeCCC--CCCCCHHHHHhccCcccccccCCccchhhhhcCCCCCCcCCCHHHHHHHHHHhCCCC
Confidence            999999999999999999999  999999999999999999999999999999999524899999999999999999999


Q ss_pred             CCCeEEEecCCCcccHHHHHHhhhCCCEEEEecCCCCChHHHHhcC
Q psy7981         169 AGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSP  214 (216)
Q Consensus       169 ~Gk~vvViGrS~~VG~Pla~lL~~~~ATVtichs~T~~l~~~~k~a  214 (216)
                      +||+|||||||++||+|+++||+++|||||+|||+|+||++++++|
T Consensus       158 ~GK~vvViGrS~iVGkPla~lL~~~~ATVtichs~T~~L~~~~~~A  203 (288)
T PRK14171        158 TGKNVVIIGRSNIVGKPLSALLLKENCSVTICHSKTHNLSSITSKA  203 (288)
T ss_pred             CCCEEEEECCCCcchHHHHHHHHHCCCEEEEeCCCCCCHHHHHhhC
Confidence            9999999999999999999999999999999999999999999997

>PRK14170 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02516 methylenetetrahydrofolate dehydrogenase (NADP+) Back     alignment and domain information
>PRK14187 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02616 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>COG0190 FolD 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK14169 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PLN02897 tetrahydrofolate dehydrogenase/cyclohydrolase, putative Back     alignment and domain information
>PRK14190 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14172 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14166 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14177 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14182 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14193 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14167 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14173 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14176 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14168 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14186 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14185 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14183 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14181 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK10792 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14180 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14184 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14189 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14191 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14175 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14179 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14174 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14194 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14178 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>PRK14188 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG4230|consensus Back     alignment and domain information
>PRK14192 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional Back     alignment and domain information
>KOG0089|consensus Back     alignment and domain information
>PF00763 THF_DHG_CYH: Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; InterPro: IPR020630 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd01079 NAD_bind_m-THF_DH NAD binding domain of methylene-tetrahydrofolate dehydrogenase Back     alignment and domain information
>PF02882 THF_DHG_CYH_C: Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain; InterPro: IPR020631 Enzymes that participate in the transfer of one-carbon units require the coenzyme tetrahydrofolate (THF) Back     alignment and domain information
>cd05212 NAD_bind_m-THF_DH_Cyclohyd_like NAD(P) binding domain of methylene-tetrahydrofolate dehydrogenase and methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>cd05191 NAD_bind_amino_acid_DH NAD(P) binding domain of amino acid dehydrogenase-like proteins Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK12749 quinate/shikimate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PRK14804 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK14805 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PLN02520 bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00670 asp_carb_tr aspartate carbamoyltransferase Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PLN02342 ornithine carbamoyltransferase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PRK01713 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK12562 ornithine carbamoyltransferase subunit F; Provisional Back     alignment and domain information
>PRK02255 putrescine carbamoyltransferase; Provisional Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>TIGR00658 orni_carb_tr ornithine carbamoyltransferase Back     alignment and domain information
>PRK03515 ornithine carbamoyltransferase subunit I; Provisional Back     alignment and domain information
>PRK00856 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>PRK07200 aspartate/ornithine carbamoyltransferase family protein; Validated Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>PRK00779 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>PLN02527 aspartate carbamoyltransferase Back     alignment and domain information
>PRK02102 ornithine carbamoyltransferase; Validated Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>TIGR03316 ygeW probable carbamoyltransferase YgeW Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK11891 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PRK04284 ornithine carbamoyltransferase; Provisional Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13814 pyrB aspartate carbamoyltransferase catalytic subunit; Provisional Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK10401 DNA-binding transcriptional regulator GalS; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09492 treR trehalose repressor; Provisional Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08192 aspartate carbamoyltransferase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>PF00731 AIRC: AIR carboxylase; InterPro: IPR000031 Phosphoribosylaminoimidazole carboxylase is a fusion protein in plants and fungi, but consists of two non-interacting proteins in bacteria, PurK and PurE Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK02929 L-arabinose isomerase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK14987 gluconate operon transcriptional regulator; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK04523 N-acetylornithine carbamoyltransferase; Reviewed Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>cd03557 L-arabinose_isomerase L-Arabinose isomerase (AI) catalyzes the isomerization of L-arabinose to L-ribulose, the first reaction in its conversion into D-xylulose-5-phosphate, an intermediate in the pentose phosphate pathway, which allows L-arabinose to be used as a carbon source Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>PRK13376 pyrB bifunctional aspartate carbamoyltransferase catalytic subunit/aspartate carbamoyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK05562 precorrin-2 dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>cd00578 L-fuc_L-ara-isomerases L-fucose isomerase (FucIase) and L-arabinose isomerase (AI) family; composed of FucIase, AI and similar proteins Back     alignment and domain information
>PRK11041 DNA-binding transcriptional regulator CytR; Provisional Back     alignment and domain information
>PRK00676 hemA glutamyl-tRNA reductase; Validated Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02405 trehalos_R_Ecol trehalose operon repressor, proteobacterial Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG0281 SfcA Malic enzyme [Energy production and conversion] Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>COG0499 SAM1 S-adenosylhomocysteine hydrolase [Coenzyme metabolism] Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12862 malic enzyme; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PRK07232 bifunctional malic enzyme oxidoreductase/phosphotransacetylase; Reviewed Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0078 ArgF Ornithine carbamoyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14982 acyl-ACP reductase; Provisional Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1a4i_A301 Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE 1e-59
1dia_A306 Human Methylenetetrahydrofolate Dehydrogenase Cyclo 1e-59
4b4u_A303 Crystal Structure Of Acinetobacter Baumannii N5, N1 8e-34
4a26_A300 The Crystal Structure Of Leishmania Major N5,N10- M 2e-32
3p2o_A285 Crystal Structure Of Fold Bifunctional Protein From 1e-31
3l07_A285 Methylenetetrahydrofolate DehydrogenaseMETHENYLTETR 2e-30
4a5o_A286 Crystal Structure Of Pseudomonas Aeruginosa N5, N10 6e-29
1b0a_A288 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCL 3e-28
2c2x_A281 Three Dimensional Structure Of Bifunctional Methyle 1e-26
3ngl_A276 Crystal Structure Of Bifunctional 5,10-Methylenetet 3e-20
1edz_A320 Structure Of The Nad-Dependent 5,10- Methylenetetra 1e-05
>pdb|1A4I|A Chain A, Human Tetrahydrofolate Dehydrogenase CYCLOHYDROLASE Length = 301 Back     alignment and structure 
Iteration: 1

 Score =  226 bits (575), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (70%), Gaps = 1/203 (0%)
Query: 10  AQILSGTAVSGDIXXXXXXXXXXXXXXXPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEI 69
           A+IL+G  +S  I               P F P LAI+QVG R+DSN+YI +K+KAA+EI
Sbjct: 4   AEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEI 63
Query: 70  GIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKD 129
           GI A H+KLPR+ TE E++  +  LNED +VHG +VQ+PLDS+N IN   V ++++PEKD
Sbjct: 64  GIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD 123
Query: 130 VDGLNTINEGRVAIGDMNG-FIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAE 188
           VDGL +IN GR+A GD+N  FIPCTP G LELIK T V IAG +AVV+GRSKIVG P  +
Sbjct: 124 VDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHD 183
Query: 189 LLKWKHATVTVCHSKTKNIQDVV 211
           LL W +ATVT CHSKT ++ + V
Sbjct: 184 LLLWNNATVTTCHSKTAHLDEEV 206
>pdb|1DIA|A Chain A, Human Methylenetetrahydrofolate Dehydrogenase Cyclohydrolase Complexed With Nadp And Inhibitor Ly249543 Length = 306 Back     alignment and structure
>pdb|4B4U|A Chain A, Crystal Structure Of Acinetobacter Baumannii N5, N10-Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Complexed With Nadp Cofactor Length = 303 Back     alignment and structure
>pdb|4A26|A Chain A, The Crystal Structure Of Leishmania Major N5,N10- Methylenetetrahydrofolate DehydrogenaseCYCLOHYDROLASE Length = 300 Back     alignment and structure
>pdb|3P2O|A Chain A, Crystal Structure Of Fold Bifunctional Protein From Campylobacter Jejuni Length = 285 Back     alignment and structure
>pdb|3L07|A Chain A, Methylenetetrahydrofolate DehydrogenaseMETHENYLTETRAHYDROFOLATE Cyclohydrolase, Putative Bifunctional Protein Fold From Francisella Tularensis. Length = 285 Back     alignment and structure
>pdb|4A5O|A Chain A, Crystal Structure Of Pseudomonas Aeruginosa N5, N10- Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase (Fold) Length = 286 Back     alignment and structure
>pdb|1B0A|A Chain A, 5,10, Methylene-Tetrahydropholate DehydrogenaseCYCLOHYDROLASE FROM E COLI Length = 288 Back     alignment and structure
>pdb|2C2X|A Chain A, Three Dimensional Structure Of Bifunctional Methylenetetrahydrofolate Dehydrogenase-Cyclohydrolase From Mycobacterium Tuberculosis Length = 281 Back     alignment and structure
>pdb|3NGL|A Chain A, Crystal Structure Of Bifunctional 5,10-Methylenetetrahydrofolate Dehydrogenase CYCLOHYDROLASE FROM THERMOPLASMA ACIDOPHILUM Length = 276 Back     alignment and structure
>pdb|1EDZ|A Chain A, Structure Of The Nad-Dependent 5,10- Methylenetetrahydrofolate Dehydrogenase From Saccharomyces Cerevisiae Length = 320 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query216
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 1e-105
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 2e-96
3l07_A285 Bifunctional protein fold; structural genomics, ID 7e-84
3p2o_A285 Bifunctional protein fold; structural genomics, ce 1e-83
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 1e-81
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 2e-81
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 3e-79
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 4e-76
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 2e-71
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Length = 301 Back     alignment and structure
 Score =  303 bits (779), Expect = e-105
 Identities = 119/205 (58%), Positives = 155/205 (75%), Gaps = 1/205 (0%)

Query: 10  AQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEI 69
           A+IL+G  +S  IR  LK +V +LKE++P F P LAI+QVG R+DSN+YI +K+KAA+EI
Sbjct: 4   AEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEI 63

Query: 70  GIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKD 129
           GI A H+KLPR+ TE E++  +  LNED +VHG +VQ+PLDS+N IN   V ++++PEKD
Sbjct: 64  GIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD 123

Query: 130 VDGLNTINEGRVAIGDMN-GFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAE 188
           VDGL +IN GR+A GD+N  FIPCTP G LELIK T V IAG +AVV+GRSKIVG P  +
Sbjct: 124 VDGLTSINAGRLARGDLNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHD 183

Query: 189 LLKWKHATVTVCHSKTKNIQDVVKS 213
           LL W +ATVT CHSKT ++ + V  
Sbjct: 184 LLLWNNATVTTCHSKTAHLDEEVNK 208
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Length = 300 Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Length = 285 Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Length = 285 Back     alignment and structure
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Length = 288 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Length = 286 Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Length = 281 Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Length = 276 Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Length = 320 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
4b4u_A303 Bifunctional protein fold; oxidoreductase; HET: NA 100.0
1b0a_A288 Protein (fold bifunctional protein); folate, dehyd 100.0
4a5o_A286 Bifunctional protein fold; oxidoreductase, hydrola 100.0
1a4i_A301 Methylenetetrahydrofolate dehydrogenase / methenyl 100.0
2c2x_A281 Methylenetetrahydrofolate dehydrogenase- methenylt 100.0
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 100.0
3p2o_A285 Bifunctional protein fold; structural genomics, ce 100.0
3l07_A285 Bifunctional protein fold; structural genomics, ID 100.0
3ngx_A276 Bifunctional protein fold; methylenetetrahydrofola 100.0
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 100.0
1nvt_A 287 Shikimate 5'-dehydrogenase; structural genomics, P 99.53
1nyt_A 271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 99.52
2d5c_A 263 AROE, shikimate 5-dehydrogenase; substrate, dimer, 99.5
2hk9_A 275 Shikimate dehydrogenase; shikimate pathway, drug d 99.43
1p77_A 272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 99.36
2egg_A 297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 99.27
3fbt_A 282 Chorismate mutase and shikimate 5-dehydrogenase fu 98.89
3tnl_A 315 Shikimate dehydrogenase; structural genomics, cent 98.63
3o8q_A 281 Shikimate 5-dehydrogenase I alpha; structural geno 97.51
3pwz_A 272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 97.28
3don_A 277 Shikimate dehydrogenase; alpha-beta structure, ros 97.21
3jyo_A 283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 96.95
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 96.82
3t4e_A 312 Quinate/shikimate dehydrogenase; structural genomi 96.73
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 96.67
3phh_A 269 Shikimate dehydrogenase; shikimate pathway, helico 95.89
1lu9_A 287 Methylene tetrahydromethanopterin dehydrogenase; a 95.79
3n58_A 464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 95.75
1leh_A 364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 95.73
1pg5_A 299 Aspartate carbamoyltransferase; 2.60A {Sulfolobus 95.71
1npy_A 271 Hypothetical shikimate 5-dehydrogenase-like protei 95.62
2dvm_A 439 Malic enzyme, 439AA long hypothetical malate oxido 95.43
3e8x_A 236 Putative NAD-dependent epimerase/dehydratase; stru 95.39
4f2g_A 309 Otcase 1, ornithine carbamoyltransferase 1; struct 95.1
3aoe_E 419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 94.92
3k92_A 424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 94.89
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 94.78
2i6u_A 307 Otcase, ornithine carbamoyltransferase; X-RAY crys 94.77
3aog_A 440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 94.74
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 94.54
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 94.49
2ef0_A 301 Ornithine carbamoyltransferase; TTHA1199, thermus 94.46
1vl6_A 388 Malate oxidoreductase; TM0542, NAD-dependent malic 94.46
1pvv_A 315 Otcase, ornithine carbamoyltransferase; dodecamer; 94.29
3sds_A 353 Ornithine carbamoyltransferase, mitochondrial; str 94.29
3csu_A 310 Protein (aspartate carbamoyltransferase); transfer 94.29
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 94.28
4a8t_A 339 Putrescine carbamoyltransferase; trabnsferase PALO 94.22
2yfq_A 421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 94.21
3gvp_A 435 Adenosylhomocysteinase 3; protein CO-factor comple 94.2
1dxh_A 335 Ornithine carbamoyltransferase; transcarbamylase; 94.1
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 94.09
2w37_A 359 Ornithine carbamoyltransferase, catabolic; transca 94.02
3i1j_A 247 Oxidoreductase, short chain dehydrogenase/reducta; 94.0
1c1d_A 355 L-phenylalanine dehydrogenase; amino acid dehydrog 93.99
3rih_A 293 Short chain dehydrogenase or reductase; structural 93.97
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 93.93
1oth_A 321 Protein (ornithine transcarbamoylase); transferase 93.84
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 93.8
3gd5_A 323 Otcase, ornithine carbamoyltransferase; structural 93.79
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 93.79
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 93.77
1vlv_A 325 Otcase, ornithine carbamoyltransferase; TM1097, st 93.71
3gem_A 260 Short chain dehydrogenase; structural genomics, AP 93.69
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 93.69
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 93.63
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 93.63
4amu_A 365 Ornithine carbamoyltransferase, catabolic; ornithi 93.58
1yb1_A 272 17-beta-hydroxysteroid dehydrogenase type XI; shor 93.58
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 93.56
4a8p_A 355 Putrescine carbamoyltransferase; ornithine agmatin 93.55
4iin_A 271 3-ketoacyl-acyl carrier protein reductase (FABG); 93.55
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 93.51
1v9l_A 421 Glutamate dehydrogenase; protein-NAD complex, oxid 93.51
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 93.51
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 93.47
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 93.47
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 93.47
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 93.46
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 93.45
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 93.45
1xq1_A 266 Putative tropinone reducatse; structural genomics, 93.43
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 93.38
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 93.32
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 93.29
4dqx_A 277 Probable oxidoreductase protein; structural genomi 93.25
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 93.25
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 93.23
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 93.23
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 93.21
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 93.19
3rkr_A 262 Short chain oxidoreductase; rossmann fold; HET: NA 93.19
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 93.18
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 93.14
2tmg_A 415 Protein (glutamate dehydrogenase); metabolic role, 93.12
3jtm_A 351 Formate dehydrogenase, mitochondrial; mitochondrio 93.08
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 92.97
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 92.92
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 92.67
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 92.64
4dmm_A 269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 92.62
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 92.61
1duv_G 333 Octase-1, ornithine transcarbamoylase; enzyme-inhi 92.59
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 92.59
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 92.58
3r7f_A 304 Aspartate carbamoyltransferase; aspartate transcar 92.56
3grf_A 328 Ornithine carbamoyltransferase; ornithine transcar 92.52
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 92.52
3cxt_A 291 Dehydrogenase with different specificities; rossma 92.42
3v2g_A 271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 92.41
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 92.39
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 92.39
1xhl_A 297 Short-chain dehydrogenase/reductase family member 92.31
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 92.27
3dbi_A 338 Sugar-binding transcriptional regulator, LACI FAM; 92.25
2c07_A 285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 92.25
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 92.23
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 92.21
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 92.18
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 92.16
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 92.16
3d6n_B291 Aspartate carbamoyltransferase; reactor, chamber, 92.14
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 92.09
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 92.06
1gtm_A 419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 92.06
2o4c_A 380 Erythronate-4-phosphate dehydrogenase; erythronate 92.03
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 92.02
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 92.01
4ekn_B 306 Aspartate carbamoyltransferase; atcase, aspartate 91.89
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 91.76
3tpf_A 307 Otcase, ornithine carbamoyltransferase; structural 91.74
3d64_A 494 Adenosylhomocysteinase; structural genomics, ssgci 91.7
3dfz_A 223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 91.62
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 91.57
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 91.56
3mw9_A 501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 91.48
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 91.37
1qpz_A 340 PURA, protein (purine nucleotide synthesis repress 91.35
3oet_A 381 Erythronate-4-phosphate dehydrogenase; structural 91.29
2rir_A300 Dipicolinate synthase, A chain; structural genomic 91.28
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 91.2
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 91.16
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 91.15
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 91.12
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 91.04
1jye_A 349 Lactose operon repressor; gene regulation, protein 90.92
3orf_A 251 Dihydropteridine reductase; alpha-beta-alpha sandw 90.87
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 90.8
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 90.77
4h31_A 358 Otcase, ornithine carbamoyltransferase; structural 90.75
1ml4_A 308 Aspartate transcarbamoylase; beta pleated sheet, p 90.68
3u5t_A 267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 90.64
1bgv_A 449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 90.4
2bka_A 242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 90.38
2o7s_A 523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 90.34
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 90.32
4iiu_A 267 3-oxoacyl-[acyl-carrier protein] reductase; struct 90.3
3un1_A 260 Probable oxidoreductase; structural genomics, PSI- 90.25
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 90.22
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 90.08
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 89.95
2yfk_A 418 Aspartate/ornithine carbamoyltransferase; transcar 89.87
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 89.83
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 89.78
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 89.77
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 89.39
4fcc_A 450 Glutamate dehydrogenase; protein complex, rossmann 89.25
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 89.11
2bma_A 470 Glutamate dehydrogenase (NADP+); malaria, drug des 89.04
4ep1_A 340 Otcase, ornithine carbamoyltransferase; structural 88.88
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 88.85
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 88.84
2a9f_A 398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 88.8
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 88.79
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 88.75
1jx6_A 342 LUXP protein; protein-ligand complex, signaling pr 88.65
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 88.29
4g2n_A 345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 88.27
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 88.07
2hcy_A 347 Alcohol dehydrogenase 1; tetramer of asymmetric di 87.95
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 87.87
3q98_A 399 Transcarbamylase; rossmann fold, transferase; 2.00 87.77
1pqw_A 198 Polyketide synthase; rossmann fold, dimer, structu 87.73
4dgs_A 340 Dehydrogenase; structural genomics, PSI-biology, N 87.63
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 87.61
2cuk_A 311 Glycerate dehydrogenase/glyoxylate reductase; stru 87.6
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 87.55
3gms_A 340 Putative NADPH:quinone reductase; structural genom 87.47
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 87.46
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 87.46
3ba1_A 333 HPPR, hydroxyphenylpyruvate reductase; two domain 87.43
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 87.26
1lss_A140 TRK system potassium uptake protein TRKA homolog; 87.22
3pp8_A 315 Glyoxylate/hydroxypyruvate reductase A; structural 87.17
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 87.15
2gcg_A 330 Glyoxylate reductase/hydroxypyruvate reductase; NA 87.06
2yq5_A 343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 86.93
3gvx_A 290 Glycerate dehydrogenase related protein; NYSGXRC, 86.79
1dxy_A 333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 86.67
1rjw_A 339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 86.64
1xdw_A 331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 86.51
1yqd_A 366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 86.31
4e5n_A 330 Thermostable phosphite dehydrogenase; D-2-hydroxya 86.15
1zq6_A 359 Otcase, ornithine carbamoyltransferase; alpha/beta 86.06
2w2k_A 348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 86.04
3k5p_A 416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 85.89
1qp8_A 303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 85.83
3kjx_A 344 Transcriptional regulator, LACI family; LACL famil 85.77
3dtt_A 245 NADP oxidoreductase; structural genomics, joint ce 85.65
3jvd_A333 Transcriptional regulators; structural genomics, P 85.31
2ekl_A 313 D-3-phosphoglycerate dehydrogenase; structural gen 85.17
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 85.13
4gcm_A 312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 85.13
1mx3_A 347 CTBP1, C-terminal binding protein 1; nuclear prote 85.09
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 84.93
2d0i_A 333 Dehydrogenase; structural genomics, NPPSFA, nation 84.78
3c85_A183 Putative glutathione-regulated potassium-efflux S 84.72
3ctp_A330 Periplasmic binding protein/LACI transcriptional; 84.72
4a5l_A 314 Thioredoxin reductase; oxidoreductase, redox metab 84.51
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 84.49
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 84.45
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 84.39
3evt_A 324 Phosphoglycerate dehydrogenase; structural genomic 84.32
1l7d_A 384 Nicotinamide nucleotide transhydrogenase, subunit 84.28
1wwk_A 307 Phosphoglycerate dehydrogenase; riken structural g 84.15
3h5t_A 366 Transcriptional regulator, LACI family; DNA-depend 84.09
3bil_A 348 Probable LACI-family transcriptional regulator; st 83.99
3hg7_A 324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 83.89
2cf5_A 357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 83.87
3rg8_A159 Phosphoribosylaminoimidazole carboxylase, PURE PR; 83.83
3h5o_A 339 Transcriptional regulator GNTR; transcription regu 83.67
2pi1_A 334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 83.64
1iz0_A 302 Quinone oxidoreductase; APO-enzyme, riken structur 83.63
1jvb_A 347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 83.61
2dbq_A 334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 83.61
3gg9_A 352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 83.58
3r3j_A 456 Glutamate dehydrogenase; rossman fold, oxidoreduct 83.57
3k9c_A 289 Transcriptional regulator, LACI family protein; PS 83.52
4b7c_A 336 Probable oxidoreductase; NADP cofactor, rossmann f 83.48
1wly_A 333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 83.47
1v3u_A 333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 83.19
3qvo_A 236 NMRA family protein; structural genomics, PSI-biol 83.16
1j4a_A 333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 82.92
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 82.84
2g76_A 335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 82.55
1gdh_A 320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 82.44
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 82.44
3kzn_A 359 Aotcase, N-acetylornithine carbamoyltransferase; t 82.22
4hy3_A 365 Phosphoglycerate oxidoreductase; PSI-biology, stru 81.9
4f2d_A 500 L-arabinose isomerase; structural genomics, PSI-1, 81.88
2eez_A 369 Alanine dehydrogenase; TTHA0216, structural genomi 81.77
2c0c_A 362 Zinc binding alcohol dehydrogenase, domain contain 80.95
4eye_A 342 Probable oxidoreductase; structural genomics, niai 80.9
2raf_A 209 Putative dinucleotide-binding oxidoreductase; NP_7 80.87
4grd_A173 N5-CAIR mutase, phosphoribosylaminoimidazole carbo 80.87
1sc6_A 404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 80.83
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 80.67
1yb5_A 351 Quinone oxidoreductase; medium-chain dehydrogenase 80.48
1uuf_A 369 YAHK, zinc-type alcohol dehydrogenase-like protein 80.37
3p2y_A 381 Alanine dehydrogenase/pyridine nucleotide transhy; 80.32
2j6i_A 364 Formate dehydrogenase; oxidoreductase, D-specific- 80.26
3qwb_A 334 Probable quinone oxidoreductase; rossmann fold, qu 80.03
>4b4u_A Bifunctional protein fold; oxidoreductase; HET: NAP; 1.45A {Acinetobacter baumannii atcc 19606} PDB: 4b4v_A* 4b4w_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-76  Score=524.15  Aligned_cols=203  Identities=40%  Similarity=0.686  Sum_probs=197.6

Q ss_pred             hhhhhcccHHHHHHHHHHHHHHHHHHHhcCCCCCceEEEEEeCCCcchHHHHHHHHHHHHHcCcceEEEeCCCCCCHHHH
Q psy7981           8 QQAQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIEL   87 (216)
Q Consensus         8 ~~a~il~Gk~vA~~i~~~ik~~v~~l~~~~~~~~P~LaiI~vg~~~as~~Yv~~k~k~a~~~Gi~~~~~~l~~~~~~~el   87 (216)
                      .||+|||||++|++|+++++++++.|+++ .|++|+||+|+||+||+|..|+++|.|+|+++||+++.++||++++|+||
T Consensus        21 ~Ma~ildGk~iA~~i~~~l~~~v~~l~~~-~g~~P~LavIlVG~dpaS~~Yv~~K~k~c~~vGi~s~~~~lp~~~se~el   99 (303)
T 4b4u_A           21 HMALVLDGRALAKQIEENLLVRVEALKAK-TGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQL   99 (303)
T ss_dssp             -CCEECCHHHHHHHHHHHHHHHHHHHHHH-HSCCCEEEEEEESCCHHHHHHHHHHHHHHHHTTCEEEEEEECTTCCHHHH
T ss_pred             CCCEEeehHHHHHHHHHHHHHHHHHHHHc-CCCCCcEEEEEeCCCHHHHHHHHHHHHHHHHcCCeEEEEecCccCCHHHH
Confidence            47999999999999999999999999864 48999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHhcCCCCccEEEEeCCCCCCCCCCHHHHhhhcCCCCCcccCCccchhHhhcCCCCCcccCCHHHHHHHHHHhCCC
Q psy7981          88 LSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVLELIKRTNVT  167 (216)
Q Consensus        88 ~~~I~~lN~D~~V~GIlvqlPL~~P~~id~~~i~~~I~p~KDVDG~~~~n~G~l~~~~~~~~~PcTa~av~~lL~~~~i~  167 (216)
                      ++.|++||+|++|||||||+||  |+|+|+++++++|+|+||||||||+|+|+|+.|. ..|+||||+||++||++|+++
T Consensus       100 l~~I~~LN~D~~V~GIlVQlPL--P~hid~~~i~~~I~p~KDVDG~hp~N~G~L~~g~-~~~~PcTp~gv~~lL~~~~i~  176 (303)
T 4b4u_A          100 LAEIEKLNANPDVHGILLQHPV--PAQIDERACFDAISLAKDVDGVTCLGFGRMAMGE-AAYGSATPAGIMTILKENNIE  176 (303)
T ss_dssp             HHHHHHHHTCTTCCEEEECSSC--CTTSCHHHHHHHSCGGGCTTCCCHHHHHHHHTTC-CCCCCHHHHHHHHHHHHTTCC
T ss_pred             HHHHHHhcCCCCccEEEEeCCC--ccccChHHHHhccCcccccCccCcchHHHhcCCC-CcccCccHHHHHHHHHHHCCC
Confidence            9999999999999999999999  9999999999999999999999999999999994 499999999999999999999


Q ss_pred             CCCCeEEEecCCCcccHHHHHHhhhCCCEEEEecCCCCChHHHHhcC
Q psy7981         168 IAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSP  214 (216)
Q Consensus       168 l~Gk~vvViGrS~~VG~Pla~lL~~~~ATVtichs~T~~l~~~~k~a  214 (216)
                      ++||+|||||||++||+|+|+||+++|||||+|||+|+||++++++|
T Consensus       177 l~Gk~vvViGRS~iVGkPla~LL~~~~ATVTi~Hs~T~dl~~~~~~A  223 (303)
T 4b4u_A          177 IAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQA  223 (303)
T ss_dssp             CTTCEEEEECCCTTTHHHHHHHHHHTTCEEEEECTTCSSHHHHHHTC
T ss_pred             CCCCEEEEEeccccccchHHHHHHhcCCEEEEecCCCCCHHHHhhcC
Confidence            99999999999999999999999999999999999999999999998
>1b0a_A Protein (fold bifunctional protein); folate, dehydrogenase, cyclcohydrolase, channeling, oxidoreductase,hydrolase; 2.56A {Escherichia coli K12} SCOP: c.2.1.7 c.58.1.2 Back     alignment and structure
>4a5o_A Bifunctional protein fold; oxidoreductase, hydrolase; 2.20A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>1a4i_A Methylenetetrahydrofolate dehydrogenase / methenyltetrahydrofolate cyclohydrolase...; THF, bifunctional, oxidoreductase; HET: NDP; 1.50A {Homo sapiens} SCOP: c.2.1.7 c.58.1.2 PDB: 1dia_A* 1dib_A* 1dig_A* Back     alignment and structure
>2c2x_A Methylenetetrahydrofolate dehydrogenase- methenyltetrahydrofolate cyclohydrolase; NADP; 2.0A {Mycobacterium tuberculosis} PDB: 2c2y_A Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>3p2o_A Bifunctional protein fold; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; HET: NAD; 2.23A {Campylobacter jejuni subsp} Back     alignment and structure
>3l07_A Bifunctional protein fold; structural genomics, IDP01849, methylenetetrahydrofolate dehydrogenase; 1.88A {Francisella tularensis} Back     alignment and structure
>3ngx_A Bifunctional protein fold; methylenetetrahydrofolate dehydrogenase/cyclohydrolase; 2.30A {Thermoplasma acidophilum} PDB: 3ngl_A Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2d5c_A AROE, shikimate 5-dehydrogenase; substrate, dimer, structural genomics, NPPSFA, Na project on protein structural and functional analyses; HET: SKM; 1.65A {Thermus thermophilus} PDB: 1wxd_A* 2cy0_A* 2ev9_A* Back     alignment and structure
>2hk9_A Shikimate dehydrogenase; shikimate pathway, drug design, oxidoreductase; HET: ATR SKM NAP; 2.20A {Aquifex aeolicus} PDB: 2hk8_A 2hk7_A Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1pg5_A Aspartate carbamoyltransferase; 2.60A {Sulfolobus acidocaldarius} SCOP: c.78.1.1 c.78.1.1 PDB: 2be9_A* Back     alignment and structure
>1npy_A Hypothetical shikimate 5-dehydrogenase-like protein HI0607; structural genomics, PSI, protein structure initiative; 1.75A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>2dvm_A Malic enzyme, 439AA long hypothetical malate oxidoreductase; NAD, structural genomics, NPPSFA; HET: NAD MES; 1.60A {Pyrococcus horikoshii} PDB: 1ww8_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4f2g_A Otcase 1, ornithine carbamoyltransferase 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2i6u_A Otcase, ornithine carbamoyltransferase; X-RAY crystallography, ornithine carbamyoltransferase, carbamoyl phosphate, L- norvaline; 2.20A {Mycobacterium tuberculosis} PDB: 2p2g_A Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2ef0_A Ornithine carbamoyltransferase; TTHA1199, thermus thermophil structural genomics, NPPSFA; 2.00A {Thermus thermophilus} Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1pvv_A Otcase, ornithine carbamoyltransferase; dodecamer; 1.87A {Pyrococcus furiosus} SCOP: c.78.1.1 c.78.1.1 PDB: 1a1s_A Back     alignment and structure
>3sds_A Ornithine carbamoyltransferase, mitochondrial; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.80A {Coccidioides immitis} Back     alignment and structure
>3csu_A Protein (aspartate carbamoyltransferase); transferase (carbamoyl-P; 1.88A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1r0b_A* 1q95_A* 1raa_A* 1rab_A* 1rac_A* 1rad_A* 1rae_A* 1raf_A* 1rag_A* 1rah_A* 1rai_A* 1r0c_A* 1za2_A* 1za1_A* 2fzc_A* 2fzg_A* 2fzk_A* 2h3e_A* 2ipo_A* 2qg9_A ... Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4a8t_A Putrescine carbamoyltransferase; trabnsferase PALO, delta-N-(phosphonoacetyl)-L- ornithine, agmatine deiminase route, agmatine catabolism; HET: PAO PGE; 1.59A {Enterococcus faecalis} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1dxh_A Ornithine carbamoyltransferase; transcarbamylase; 2.50A {Pseudomonas aeruginosa} SCOP: c.78.1.1 c.78.1.1 PDB: 1ort_A Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>2w37_A Ornithine carbamoyltransferase, catabolic; transcarbamylase, metal binding-site, hexamer, cytoplasm, arginine metabolism; 2.10A {Lactobacillus hilgardii} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1oth_A Protein (ornithine transcarbamoylase); transferase; HET: PAO; 1.85A {Homo sapiens} SCOP: c.78.1.1 c.78.1.1 PDB: 1ep9_A 1fvo_A 1c9y_A* 1fb5_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3gd5_A Otcase, ornithine carbamoyltransferase; structural genomics, NYSGXRC, target 9454P, operon, amino-acid biosynthesis, ARGI biosynthesis; 2.10A {Gloeobacter violaceus} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1vlv_A Otcase, ornithine carbamoyltransferase; TM1097, structural genomics, protein structure initiative, PSI, joint center for structu genomics; 2.25A {Thermotoga maritima} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4amu_A Ornithine carbamoyltransferase, catabolic; ornithine transcarbamoylase, hydrolase; 2.50A {Mycoplasma penetrans} PDB: 4anf_A Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>4a8p_A Putrescine carbamoyltransferase; ornithine agmatine deiminase route; HET: PAO; 2.00A {Enterococcus faecalis} PDB: 4a8h_A* 3txx_A Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>1duv_G Octase-1, ornithine transcarbamoylase; enzyme-inhibitor complex, transferase; HET: PSQ; 1.70A {Escherichia coli} SCOP: c.78.1.1 c.78.1.1 PDB: 1akm_A* 2otc_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3r7f_A Aspartate carbamoyltransferase; aspartate transcarbamoylase, carbamoyl phosphate, transferas catalytic cycle; 2.10A {Bacillus subtilis} PDB: 3r7d_A 3r7l_A* 2at2_A Back     alignment and structure
>3grf_A Ornithine carbamoyltransferase; ornithine transcarbamoylase, arginine degradation pathway, giardia lamblia, drug target; 2.00A {Giardia intestinalis} Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3d6n_B Aspartate carbamoyltransferase; reactor, chamber, pores, internal cavity, hydrolase, metal-B pyrimidine biosynthesis, hydrolase-transferase; HET: FLC; 2.30A {Aquifex aeolicus} Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>4ekn_B Aspartate carbamoyltransferase; atcase, aspartate transcarbamoylase, pyrimidine biosynthesis thermostability, substrate channeling; 2.50A {Methanocaldococcus jannaschii} PDB: 3e2p_A 2rgw_A Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3tpf_A Otcase, ornithine carbamoyltransferase; structural genomics, center for structural genomics of infec diseases, csgid, rossman fold; 2.70A {Campylobacter jejuni subsp} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>4h31_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PE5; 1.70A {Vibrio vulnificus} PDB: 3upd_A* Back     alignment and structure
>1ml4_A Aspartate transcarbamoylase; beta pleated sheet, protein inhibitor complex, transferase; HET: PAL; 1.80A {Pyrococcus abyssi} SCOP: c.78.1.1 c.78.1.1 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2yfk_A Aspartate/ornithine carbamoyltransferase; transcarbamylase; 2.55A {Enterococcus faecalis} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>4ep1_A Otcase, ornithine carbamoyltransferase; structural genomics, niaid, national institute of allergy AN infectious diseases; 3.25A {Bacillus anthracis} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3q98_A Transcarbamylase; rossmann fold, transferase; 2.00A {Escherichia coli} Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>3rg8_A Phosphoribosylaminoimidazole carboxylase, PURE PR; purine biosynthesis, lyase; 1.74A {Treponema denticola} SCOP: c.23.8.0 PDB: 3rgg_A* Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3kzn_A Aotcase, N-acetylornithine carbamoyltransferase; transcarbamylase, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: KCX AOR; 1.80A {Xanthomonas campestris PV} PDB: 3kzc_A* 3kzm_A* 3kzk_A* 3kzo_A* 3m4j_A* 3m5d_A* 3m5c_A* 3l05_A* 3l02_A* 3m4n_A* 3l06_A* 3l04_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4f2d_A L-arabinose isomerase; structural genomics, PSI-1, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; HET: MSE RB0; 2.30A {Escherichia coli} PDB: 2ajt_A 2hxg_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4grd_A N5-CAIR mutase, phosphoribosylaminoimidazole carboxylase catalyti; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 216
d1a4ia2125 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/ 1e-34
d1edza2146 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/ 1e-33
d1b0aa2121 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/ 7e-26
d1a4ia1170 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehy 4e-18
d1edza1171 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehy 3e-16
d1b0aa1166 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehy 1e-12
>d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Tetrahydrofolate dehydrogenase/cyclohydrolase
domain: Tetrahydrofolate dehydrogenase/cyclohydrolase
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  117 bits (294), Expect = 1e-34
 Identities = 69/123 (56%), Positives = 95/123 (77%)

Query: 10  AQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEI 69
           A+IL+G  +S  IR  LK +V +LKE++P F P LAI+QVG R+DSN+YI +K+KAA+EI
Sbjct: 3   AEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEI 62

Query: 70  GIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKD 129
           GI A H+KLPR+ TE E++  +  LNED +VHG +VQ+PLDS+N IN   V ++++PEKD
Sbjct: 63  GIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD 122

Query: 130 VDG 132
           VDG
Sbjct: 123 VDG 125
>d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 171 Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query216
d1edza2146 Tetrahydrofolate dehydrogenase/cyclohydrolase {Bak 100.0
d1b0aa2121 Tetrahydrofolate dehydrogenase/cyclohydrolase {Esc 100.0
d1a4ia2125 Tetrahydrofolate dehydrogenase/cyclohydrolase {Hum 100.0
d1b0aa1166 Methylenetetrahydrofolate dehydrogenase/cyclohydro 99.97
d1a4ia1170 Methylenetetrahydrofolate dehydrogenase/cyclohydro 99.96
d1edza1171 Methylenetetrahydrofolate dehydrogenase/cyclohydro 99.89
d1luaa1 191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.57
d1c1da1 201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 96.96
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 96.2
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 96.05
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 95.91
d1nyta1 170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 95.88
d1vi2a1 182 Putative shikimate dehydrogenase YdiB {Escherichia 95.86
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 95.54
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 95.39
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.38
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 95.35
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 95.01
d1npya1 167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 94.99
d1leha1 230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 94.89
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 94.72
d1nvta1 177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 94.69
d1p77a1 171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 94.54
d1gtma1 239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 92.73
d1v9la1 242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 92.47
d1b26a1 234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 91.79
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.41
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.23
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 90.87
d1tuga1 310 Aspartate carbamoyltransferase catalytic subunit { 90.54
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 90.49
d1j4aa1 197 D-lactate dehydrogenase {Lactobacillus helveticus 90.43
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 90.39
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.86
d1bgva1 255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 89.85
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 89.7
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 89.53
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 89.29
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 88.87
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 88.67
d7reqa2168 Methylmalonyl-CoA mutase alpha subunit, C-terminal 88.54
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 88.18
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 88.15
d1vj0a2 182 Hypothetical protein TM0436 {Thermotoga maritima [ 88.12
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 87.96
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 87.54
d1qora2 179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 87.46
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 87.42
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 87.36
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 87.12
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 86.27
d1lqta1 216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 85.59
d1w4xa2 235 Phenylacetone monooxygenase {Thermobifida fusca [T 85.55
d1o4va_169 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 84.95
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 84.89
d1u11a_159 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 84.89
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 84.76
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 83.88
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 83.52
d1gu7a2 189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 83.12
d1xmpa_155 N5-CAIR mutase (phosphoribosylaminoimidazole carbo 83.07
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 82.98
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 82.93
d1dxya1 199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 82.65
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 82.1
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 81.86
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 81.59
d2ajta2 328 L-arabinose isomerase AraA {Escherichia coli [TaxI 81.2
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 80.96
d2bkaa1 232 TAT-interacting protein TIP30 {Human (Homo sapiens 80.75
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 80.59
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 80.52
>d1edza2 c.58.1.2 (A:3-148) Tetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Aminoacid dehydrogenase-like, N-terminal domain
superfamily: Aminoacid dehydrogenase-like, N-terminal domain
family: Tetrahydrofolate dehydrogenase/cyclohydrolase
domain: Tetrahydrofolate dehydrogenase/cyclohydrolase
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=3.9e-49  Score=316.51  Aligned_cols=143  Identities=17%  Similarity=0.184  Sum_probs=134.2

Q ss_pred             hhhcccHHHHHHHHHHHHHHHHHHHhcCCCCCceEEEEEeCCCcchHHHHHHHHHHHHHcCcceEEEeCCCCCCHHHHHH
Q psy7981          10 AQILSGTAVSGDIREGLKERVKKLKERLPDFEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLS   89 (216)
Q Consensus        10 a~il~Gk~vA~~i~~~ik~~v~~l~~~~~~~~P~LaiI~vg~~~as~~Yv~~k~k~a~~~Gi~~~~~~l~~~~~~~el~~   89 (216)
                      +++|||+++|+.|+++++++++.|+++..|++|+|++|+||+|++|.+|+++|+|+|+++||++++   ++..+++++++
T Consensus         3 gkiidG~~iA~~i~~~l~~~v~~l~~~~~g~~P~Lavilvg~d~aS~~Yv~~k~k~a~~~Gi~~~l---~~~~~~~~l~~   79 (146)
T d1edza2           3 GRTILASKVAETFNTEIINNVEEYKKTHNGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYDL---RVIEDKDFLEE   79 (146)
T ss_dssp             CEECCHHHHHHHHHHHHHHHHHHHHHHTTTCCCEEEEEECCCCHHHHHHHHHHHHHHHHHTCEEEE---EECSSGGGHHH
T ss_pred             CeeccHHHHHHHHHHHHHHHHHHHHHhcCCCCceEEEEEeCCCHHHHHHHHHHHHHHHHcCCcccc---CccchHHHHHH
Confidence            468999999999999999999999877678999999999999999999999999999999999865   45557899999


Q ss_pred             HHHHhcCCCCccEEEEeCCCCCCCCCCHHHHhhhcCCCCCcccCCccchhHhhcCCCCCcccCCHHHHH
Q psy7981          90 RLKKLNEDPSVHGIIVQMPLDSDNDINAMLVTDSVSPEKDVDGLNTINEGRVAIGDMNGFIPCTPNGVL  158 (216)
Q Consensus        90 ~I~~lN~D~~V~GIlvqlPL~~P~~id~~~i~~~I~p~KDVDG~~~~n~G~l~~~~~~~~~PcTa~av~  158 (216)
                      .|++||+|++|||||||+||  |+|+|++.++++|+|+||||||||+|+|+||.|. .++.||||+||+
T Consensus        80 ~I~~LN~D~~V~GIlvQlPL--P~~i~~~~i~~~I~p~KDVDGl~p~N~G~L~~~~-~~l~P~t~~~~i  145 (146)
T d1edza2          80 AIIQANGDDSVNGIMVYFPV--FGNAQDQYLQQVVCKEKDVEGLNHVYYQNLYHNV-RYLDKENRLKSI  145 (146)
T ss_dssp             HHHHHHHCTTCCEEEECSCS--SSSHHHHHHTTTSCTTTBTTCCSHHHHHHHHTTC-CBSSSSSCSBCC
T ss_pred             HHHHHhcchhhhhhhhcCCC--CcccCHHHHHHhcCCCCCcCCCChHhHHHHHcCC-CCCCCCCccCcc
Confidence            99999999999999999999  9999999999999999999999999999999994 488999999874
>d1b0aa2 c.58.1.2 (A:2-122) Tetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia2 c.58.1.2 (A:2-126) Tetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0aa1 c.2.1.7 (A:123-288) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a4ia1 c.2.1.7 (A:127-296) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edza1 c.2.1.7 (A:149-319) Methylenetetrahydrofolate dehydrogenase/cyclohydrolase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1tuga1 c.78.1.1 (A:1-150,A:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d7reqa2 c.23.6.1 (A:561-728) Methylmalonyl-CoA mutase alpha subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1o4va_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u11a_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Acetobacter aceti [TaxId: 435]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1xmpa_ c.23.8.1 (A:) N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ajta2 c.85.1.2 (A:1-328) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure