Diaphorina citri psyllid: psy7988


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70---
DKIHAGKSRTHDLALTRYCFVLQHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF
cccccccccHHHHHHHHHccccEEEcccccccHHHHHccccccccHHHHHHHHHHccccccccccEEEccccc
*******SRTHDLALTRYCFVLQHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSV**DQDNQVFRLDEQF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DKIHAGKSRTHDLALTRYCFVLQHYFAENPFDFMENISLEGKTNFFERKVGEYQKSSVMADQDNQVFRLDEQF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribonucleoside-diphosphate reductase subunit M2 B Plays a pivotal role in cell survival by repairing damaged DNA in a p53/TP53-dependent manner. Supplies deoxyribonucleotides for DNA repair in cells arrested at G1 or G2. Contains an iron-tyrosyl free radical center required for catalysis. Forms an active ribonucleotide reductase (RNR) complex with RRM1 which is expressed both in resting and proliferating cells in response to DNA damage.confidentQ6PEE3
Ribonucleoside-diphosphate reductase subunit M2 B Plays a pivotal role in cell survival by repairing damaged DNA in a p53/TP53-dependent manner. Supplies deoxyribonucleotides for DNA repair in cells arrested at G1 or G2. Contains an iron-tyrosyl free radical center required for catalysis. Forms an active ribonucleotide reductase (RNR) complex with RRM1 which is expressed both in resting and proliferating cells in response to DNA damage.confidentQ5R9G0
Ribonucleoside-diphosphate reductase small chain Provides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides.confidentP36603

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0009263 [BP]deoxyribonucleotide biosynthetic processprobableGO:0044249, GO:0034641, GO:0009165, GO:0044281, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0008150, GO:0071704, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009262, GO:0009117, GO:0008152, GO:0034654, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901137, GO:1901135, GO:0044237, GO:0006796, GO:0006807, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0004748 [MF]ribonucleoside-diphosphate reductase activity, thioredoxin disulfide as acceptorprobableGO:0016728, GO:0003824, GO:0003674, GO:0016725, GO:0016491
GO:0019222 [BP]regulation of metabolic processprobableGO:0008150, GO:0065007, GO:0050789
GO:0003014 [BP]renal system processprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707, GO:0003008
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0001822 [BP]kidney developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007275, GO:0044699
GO:0006264 [BP]mitochondrial DNA replicationprobableGO:0032042, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:0007005, GO:1901360, GO:0006139, GO:0000002, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0006260, GO:0006261, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0046483, GO:0006996, GO:0044238, GO:0044699, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0009200 [BP]deoxyribonucleoside triphosphate metabolic processprobableGO:0006139, GO:0044710, GO:0044238, GO:0009141, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0071704, GO:0006796, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0006793, GO:0019637, GO:0006753, GO:0055086, GO:0046483
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0014075 [BP]response to amine stimulusprobableGO:0009719, GO:1901698, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0050896
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005971 [CC]ribonucleoside-diphosphate reductase complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006979 [BP]response to oxidative stressprobableGO:0006950, GO:0008150, GO:0050896
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0009186 [BP]deoxyribonucleoside diphosphate metabolic processprobableGO:0006139, GO:0044710, GO:0006753, GO:0044238, GO:1901360, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0071704, GO:0006796, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0006793, GO:0019637, GO:0009132, GO:0055086, GO:0046483
GO:0012501 [BP]programmed cell deathprobableGO:0010259, GO:0009987, GO:0008150, GO:0044763, GO:0007569, GO:0044699
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0015949 [BP]nucleobase-containing small molecule interconversionprobableGO:0006139, GO:0044710, GO:0044238, GO:1901360, GO:0009987, GO:0006725, GO:0044237, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0055086, GO:0046483
GO:0046914 [MF]transition metal ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2P1I, chain A
Confidence level:very confident
Coverage over the Query: 14-33
View the alignment between query and template
View the model in PyMOL