Diaphorina citri psyllid: psy7994

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
VTGANKGIGYGIVKGLIQQFDGIIYLTARDASRGQEALEKLQKLDILDKNSIKALHDHLEAEHGGVDVLVNNAAIAFKVNSSEPFGSQALHTMRTNYFALIDVCDILFPLLRSHGRVVNVSSSCGHLCHVTSEALKKKLLHEIKSVEELSALMNEFVELAQDGSHTKGGWPNSAYAATKLGVTKLSFLQHALLSQDAIREDLVVNCVHPGYVNTDMSSGKGPLTIDQDNI
ccccccHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccc
VTGANKGIGYGIVKGLIQQFDGIIYLTARDASRGQEALEKLQKLDILDKNSIKALHDHLEAEHGGVDVLVNNAAIAFKVNSSEPFGSQALHTMRTNYFALIDVCDILFPLLRSHGRVVNVSSSCGHLCHVTSEALKKKLLHEIKSVEELSALMNEFVELAQDGSHTKGGWPNSAYAATKLGVTKLSFLQHALLSQDAIREDLVVNCVHPGYVNTDMSSGKGPLTIDQDNI
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VTGANKGIGYGIVKGLIQQFDGIIYLTARDASRGQEALEKLQKLDILDKNSIKALHDHLEAEHGGVDVLVNNAAIAFKVNSSEPFGSQALHTMRTNYFALIDVCDILFPLLRSHGRVVNVSSSCGHLCHVTSEALKKKLLHEIKSVEELSALMNEFVELAQDGSHTKGGWPNSAYAATKLGVTKLSFLQHALLSQDAIREDLVVNCVHPGYVNTDMSSGKGPLTIDQDNI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.confidentP16152
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.confidentP48758
Carbonyl reductase [NADPH] 1 NADPH-dependent reductase with broad substrate specificity. Catalyzes the reduction of a wide variety of carbonyl compounds including quinones, prostaglandins, menadione, plus various xenobiotics. Catalyzes the reduction of the antitumor anthracyclines doxorubicin and daunorubicin to the cardiotoxic compounds doxorubicinol and daunorubicinol. Can convert prostaglandin E2 to prostaglandin F2-alpha. Can bind glutathione, which explains its higher affinity for glutathione-conjugated substrates. Catalyzes the reduction of S-nitrosoglutathione.confidentQ5RCU5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0004090 [MF]carbonyl reductase (NADPH) activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0070402 [MF]NADPH bindingprobableGO:0043168, GO:0050662, GO:0050661, GO:0097159, GO:0000166, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0043167, GO:1901363, GO:1901265
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0042376 [BP]phylloquinone catabolic processprobableGO:0006732, GO:0044248, GO:0044710, GO:0042374, GO:0044282, GO:0009109, GO:0044712, GO:0051187, GO:0051186, GO:1901662, GO:1901661, GO:0042375, GO:0071704, GO:1901575, GO:0009987, GO:0042378, GO:0008150, GO:0008152, GO:0009056, GO:0042180, GO:0042182, GO:0044237, GO:0044281
GO:0000253 [MF]3-keto sterol reductase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0042373 [BP]vitamin K metabolic processprobableGO:0044710, GO:0006766, GO:0042180, GO:0044237, GO:0009987, GO:1901661, GO:0042375, GO:0071704, GO:0006775, GO:0008150, GO:0051186, GO:0008152, GO:0044281
GO:0016655 [MF]oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptorprobableGO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0005902 [CC]microvillusprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0017144 [BP]drug metabolic processprobableGO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.1.-.-Acting on the CH-OH group of donors.probable
1.1.1.-15-hydroxyprostaglandin dehydrogenase (NAD(+)).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WMA, chain A
Confidence level:very confident
Coverage over the Query: 1-229
View the alignment between query and template
View the model in PyMOL