Psyllid ID: psy7998


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140--
MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWIKR
ccccccccEEEcccEEEHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccEEccccccHHHHHHHHHHHHHccccccccccHHHHHHHcc
ccccccccEEccccEEEEcHHHHHHHHHHHHcccccccccccHHHHEEEccEEEEcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccEEcccccEHHHHHHHHHHHHHHHccccHHccHHHHHHHHc
mnplkkvpvlndngiyisdsHAILTYLTsqygmnsshlyprdlkkraivdsrlhfdngvlfpslaniirpmvyegqttiLEDKKKIALEALDFVEGLLKQTEwvagdkmtvaDFSLVATVTSLATLLPEVESYWKIQAWIKR
mnplkkvpvlndNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLatllpevesywkiqawikr
MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFslvatvtslatllPEVESYWKIQAWIKR
*******PVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWI**
MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWIKR
MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWIKR
MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWIKR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWIKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query142 2.2.26 [Sep-21-2011]
P46430217 Glutathione S-transferase N/A N/A 0.985 0.645 0.423 4e-28
O76483218 Glutathione S-transferase no N/A 0.985 0.642 0.373 2e-23
Q9VG97199 Glutathione S-transferase no N/A 0.964 0.688 0.374 1e-22
Q94999209 Glutathione S-transferase no N/A 0.964 0.655 0.385 5e-22
P30104209 Glutathione S-transferase N/A N/A 0.964 0.655 0.402 6e-22
P67804200 Glutathione S-transferase N/A N/A 0.964 0.685 0.395 7e-22
P67805209 Glutathione S-transferase N/A N/A 0.964 0.655 0.395 7e-22
P30106209 Glutathione S-transferase N/A N/A 0.964 0.655 0.395 7e-22
P30107200 Glutathione S-transferase N/A N/A 0.964 0.685 0.395 7e-22
P20432209 Glutathione S-transferase no N/A 0.964 0.655 0.395 1e-21
>sp|P46430|GSTT1_MANSE Glutathione S-transferase 1 OS=Manduca sexta GN=GST1 PE=2 SV=1 Back     alignment and function desciption
 Score =  123 bits (308), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 93/144 (64%), Gaps = 4/144 (2%)

Query: 1   MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVL 60
           MNP   VP+L D+   + DSHAI  YL S+YG + S LYP D KKRAIVD RLHFD+G+L
Sbjct: 49  MNPQHTVPLLKDDDFLVWDSHAIAGYLVSKYGADDS-LYPTDPKKRAIVDQRLHFDSGIL 107

Query: 61  FPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATV 120
           FP+L   + P+++ G+T    +  +   +  DF E  L  T W+AG++ TVAD   VA++
Sbjct: 108 FPALRGSLEPVIFWGETAFRPECLEKVRKGYDFAEKFLTST-WMAGEEFTVADICCVASI 166

Query: 121 TSLATLLPEVE--SYWKIQAWIKR 142
           +++  ++  ++  +Y K+ AW++R
Sbjct: 167 STMNDIIVPIDENTYPKLSAWLER 190




Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.
Manduca sexta (taxid: 7130)
EC: 2EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 8
>sp|O76483|GSTT7_ANOGA Glutathione S-transferase D7 OS=Anopheles gambiae GN=GstD7 PE=2 SV=1 Back     alignment and function description
>sp|Q9VG97|GSTT3_DROME Glutathione S-transferase D3 OS=Drosophila melanogaster GN=GstD3 PE=2 SV=1 Back     alignment and function description
>sp|Q94999|GSTT2_ANOGA Glutathione S-transferase 2 OS=Anopheles gambiae GN=GstD2 PE=3 SV=2 Back     alignment and function description
>sp|P30104|GSTT1_DROER Glutathione S-transferase 1-1 OS=Drosophila erecta GN=GstD1 PE=3 SV=2 Back     alignment and function description
>sp|P67804|GSTT1_DROMA Glutathione S-transferase 1-1 (Fragment) OS=Drosophila mauritiana GN=GstD1 PE=3 SV=1 Back     alignment and function description
>sp|P67805|GSTT1_DROSI Glutathione S-transferase 1-1 OS=Drosophila simulans GN=GstD1 PE=2 SV=2 Back     alignment and function description
>sp|P30106|GSTT1_DROSE Glutathione S-transferase 1-1 OS=Drosophila sechellia GN=GstD1 PE=3 SV=2 Back     alignment and function description
>sp|P30107|GSTT1_DROTE Glutathione S-transferase 1-1 (Fragment) OS=Drosophila teissieri GN=GstD1 PE=3 SV=1 Back     alignment and function description
>sp|P20432|GSTT1_DROME Glutathione S-transferase 1-1 OS=Drosophila melanogaster GN=GstD1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
91076570219 PREDICTED: similar to glutathione S-tran 0.992 0.643 0.475 3e-31
91078560195 PREDICTED: similar to Glutathione S tran 0.992 0.723 0.479 2e-30
195335585222 GM21882 [Drosophila sechellia] gi|194126 0.985 0.630 0.482 2e-30
91076568221 PREDICTED: similar to glutathione S-tran 0.992 0.638 0.475 1e-29
24654992222 glutathione S transferase E8 [Drosophila 0.985 0.630 0.475 4e-29
195584589222 GD11377 [Drosophila simulans] gi|1941940 0.985 0.630 0.475 7e-29
19335973222 putative glutathione S-transferase [Dros 0.985 0.630 0.475 8e-29
27820029223 GM08326p, partial [Drosophila melanogast 0.985 0.627 0.475 9e-29
195487471222 GE11965 [Drosophila yakuba] gi|194178023 0.985 0.630 0.468 1e-28
194881085222 GG21890 [Drosophila erecta] gi|190657866 0.985 0.630 0.475 1e-28
>gi|91076570|ref|XP_967313.1| PREDICTED: similar to glutathione S-transferase 6A [Tribolium castaneum] gi|270002387|gb|EEZ98834.1| hypothetical protein TcasGA2_TC004443 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  139 bits (351), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 69/145 (47%), Positives = 101/145 (69%), Gaps = 4/145 (2%)

Query: 1   MNPLKKVPVL-NDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGV 59
           +NP   VP L +D+G  I DSH I+TYL S+Y +N + LYP+DLKKRA+VD RLHF++G 
Sbjct: 48  LNPQHTVPTLVDDDGFTIWDSHVIITYLVSKYAINDA-LYPKDLKKRAVVDQRLHFESGF 106

Query: 60  LFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVAT 119
           +FP LA I RP+ +EG+ TI +  K+   EA  F+E  L   +WVAGD ++VAD+SLV+ 
Sbjct: 107 VFPRLAAISRPIFFEGKKTINQKDKESVCEAYGFLETFLNGHQWVAGDFISVADYSLVSV 166

Query: 120 VTSLATLLPEVES--YWKIQAWIKR 142
           ++SL  ++  +++  Y  + AW+KR
Sbjct: 167 ISSLNYIMVPIDAGKYPNLHAWLKR 191




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91078560|ref|XP_971136.1| PREDICTED: similar to Glutathione S transferase E8 CG17533-PA [Tribolium castaneum] gi|270003823|gb|EFA00271.1| hypothetical protein TcasGA2_TC003104 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195335585|ref|XP_002034444.1| GM21882 [Drosophila sechellia] gi|194126414|gb|EDW48457.1| GM21882 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|91076568|ref|XP_967234.1| PREDICTED: similar to glutathione S-transferase 6A [Tribolium castaneum] gi|270002388|gb|EEZ98835.1| hypothetical protein TcasGA2_TC004444 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|24654992|ref|NP_611330.2| glutathione S transferase E8 [Drosophila melanogaster] gi|7302613|gb|AAF57694.1| glutathione S transferase E8 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195584589|ref|XP_002082087.1| GD11377 [Drosophila simulans] gi|194194096|gb|EDX07672.1| GD11377 [Drosophila simulans] Back     alignment and taxonomy information
>gi|19335973|emb|CAD26834.1| putative glutathione S-transferase [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|27820029|gb|AAL68213.2| GM08326p, partial [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195487471|ref|XP_002091922.1| GE11965 [Drosophila yakuba] gi|194178023|gb|EDW91634.1| GE11965 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194881085|ref|XP_001974679.1| GG21890 [Drosophila erecta] gi|190657866|gb|EDV55079.1| GG21890 [Drosophila erecta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query142
FB|FBgn0063492223 GstE8 "Glutathione S transfera 0.985 0.627 0.433 8.4e-26
FB|FBgn0063494231 GstE6 "Glutathione S transfera 0.985 0.606 0.405 2.2e-25
FB|FBgn0063493229 GstE7 "Glutathione S transfera 0.985 0.611 0.419 4.6e-25
FB|FBgn0063497220 GstE3 "Glutathione S transfera 0.985 0.636 0.430 2.6e-24
FB|FBgn0063495226 GstE5 "Glutathione S transfera 0.978 0.615 0.402 8.7e-24
FB|FBgn0034335224 GstE1 "Glutathione S transfera 0.985 0.625 0.387 2.1e-22
FB|FBgn0063496222 GstE4 "Glutathione S transfera 0.985 0.630 0.391 4.3e-22
FB|FBgn0034354225 GstE11 "Glutathione S transfer 1.0 0.631 0.347 9e-22
FB|FBgn0027590223 GstE12 "Glutathione S transfer 1.0 0.636 0.370 2.4e-21
UNIPROTKB|O76483218 GstD7 "Glutathione S-transfera 0.985 0.642 0.352 1.7e-20
FB|FBgn0063492 GstE8 "Glutathione S transferase E8" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 292 (107.8 bits), Expect = 8.4e-26, P = 8.4e-26
 Identities = 62/143 (43%), Positives = 87/143 (60%)

Query:     2 NPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLF 61
             NP   VP L D+G +I DSHAI  YL S+YG + + LYP+DL +RA+VD RLHF++GV+F
Sbjct:    51 NPQHTVPTLEDDGHFIWDSHAISAYLVSKYGQSDT-LYPKDLLQRAVVDQRLHFESGVVF 109

Query:    62 PS-LANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFXXXXXX 120
              + L  I +P+   GQTTI +++    +E  DFVE  L   +++AGD++T+ADF      
Sbjct:   110 VNGLRGITKPLFATGQTTIPKERYDAVIEIYDFVETFLTGHDFIAGDQLTIADFSLITSI 169

Query:   121 XXXXXXXP-EVESYWKIQAWIKR 142
                      +   Y  I AWIKR
Sbjct:   170 TALAVFVVIDPVKYANITAWIKR 192




GO:0004364 "glutathione transferase activity" evidence=ISS
GO:0006749 "glutathione metabolic process" evidence=ISS
FB|FBgn0063494 GstE6 "Glutathione S transferase E6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0063493 GstE7 "Glutathione S transferase E7" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0063497 GstE3 "Glutathione S transferase E3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0063495 GstE5 "Glutathione S transferase E5" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034335 GstE1 "Glutathione S transferase E1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0063496 GstE4 "Glutathione S transferase E4" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034354 GstE11 "Glutathione S transferase E11" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0027590 GstE12 "Glutathione S transferase E12" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|O76483 GstD7 "Glutathione S-transferase D7" [Anopheles gambiae (taxid:7165)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.5.1.18LOW CONFIDENCE prediction!
3rd Layer2.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
cd03177117 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha he 1e-36
COG0625211 COG0625, Gst, Glutathione S-transferase [Posttrans 6e-21
pfam0004392 pfam00043, GST_C, Glutathione S-transferase, C-ter 4e-10
cd0304574 cd03045, GST_N_Delta_Epsilon, GST_N family, Class 4e-08
PLN02473214 PLN02473, PLN02473, glutathione S-transferase 6e-08
TIGR01262210 TIGR01262, maiA, maleylacetoacetate isomerase 1e-07
cd03189123 cd03189, GST_C_GTT1_like, C-terminal, alpha helica 2e-07
PLN02395215 PLN02395, PLN02395, glutathione S-transferase 3e-07
cd00299100 cd00299, GST_C_family, C-terminal, alpha helical d 4e-07
cd0305673 cd03056, GST_N_4, GST_N family, unknown subfamily 6e-07
cd0057071 cd00570, GST_N_family, Glutathione S-transferase ( 7e-07
cd0305076 cd03050, GST_N_Theta, GST_N family, Class Theta su 9e-07
cd03192104 cd03192, GST_C_Sigma_like, C-terminal, alpha helic 2e-06
cd0304676 cd03046, GST_N_GTT1_like, GST_N family, Saccharomy 3e-06
pfam1341069 pfam13410, GST_C_2, Glutathione S-transferase, C-t 4e-05
cd03206100 cd03206, GST_C_7, C-terminal, alpha helical domain 2e-04
cd0304273 cd03042, GST_N_Zeta, GST_N family, Class Zeta subf 3e-04
pfam1341775 pfam13417, GST_N_3, Glutathione S-transferase, N-t 3e-04
cd03182116 cd03182, GST_C_GTT2_like, C-terminal, alpha helica 6e-04
cd0304773 cd03047, GST_N_2, GST_N family, unknown subfamily 0.001
cd03178110 cd03178, GST_C_Ure2p_like, C-terminal, alpha helic 0.001
cd0304881 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-lik 0.001
COG0435324 COG0435, ECM4, Predicted glutathione S-transferase 0.002
PRK11752264 PRK11752, PRK11752, putative S-transferase; Provis 0.002
pfam1340968 pfam13409, GST_N_2, Glutathione S-transferase, N-t 0.002
PRK15113214 PRK15113, PRK15113, glutathione S-transferase; Pro 0.002
PTZ00057205 PTZ00057, PTZ00057, glutathione s-transferase; Pro 0.002
>gnl|CDD|198287 cd03177, GST_C_Delta_Epsilon, C-terminal, alpha helical domain of Class Delta and Epsilon Glutathione S-transferases Back     alignment and domain information
 Score =  121 bits (306), Expect = 1e-36
 Identities = 41/99 (41%), Positives = 65/99 (65%), Gaps = 1/99 (1%)

Query: 44  KKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEW 103
           KKRAIV+ RL FD+G L+  L +   P+++ G     E   K+  EAL+F+E  L+ +++
Sbjct: 1   KKRAIVNQRLFFDSGTLYQRLRDYYYPILFGGAEPPEEKLDKL-EEALEFLETFLEGSDY 59

Query: 104 VAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWIKR 142
           VAGD++T+AD SLVATV++L  +  ++  Y  + AW +R
Sbjct: 60  VAGDQLTIADLSLVATVSTLEVVGFDLSKYPNVAAWYER 98


Glutathione S-transferase (GST) C-terminal domain family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites that are easily excreted. They are also implicated in protection against cellular damage by oxidative stress. Length = 117

>gnl|CDD|223698 COG0625, Gst, Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215674 pfam00043, GST_C, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|239343 cd03045, GST_N_Delta_Epsilon, GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|166114 PLN02473, PLN02473, glutathione S-transferase Back     alignment and domain information
>gnl|CDD|233333 TIGR01262, maiA, maleylacetoacetate isomerase Back     alignment and domain information
>gnl|CDD|198298 cd03189, GST_C_GTT1_like, C-terminal, alpha helical domain of GTT1-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|166036 PLN02395, PLN02395, glutathione S-transferase Back     alignment and domain information
>gnl|CDD|198286 cd00299, GST_C_family, C-terminal, alpha helical domain of the Glutathione S-transferase family Back     alignment and domain information
>gnl|CDD|239354 cd03056, GST_N_4, GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|238319 cd00570, GST_N_family, Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|239348 cd03050, GST_N_Theta, GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>gnl|CDD|198301 cd03192, GST_C_Sigma_like, C-terminal, alpha helical domain of Class Sigma-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239344 cd03046, GST_N_GTT1_like, GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>gnl|CDD|222111 pfam13410, GST_C_2, Glutathione S-transferase, C-terminal domain Back     alignment and domain information
>gnl|CDD|198315 cd03206, GST_C_7, C-terminal, alpha helical domain of an unknown subfamily 7 of Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239340 cd03042, GST_N_Zeta, GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>gnl|CDD|205595 pfam13417, GST_N_3, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|198291 cd03182, GST_C_GTT2_like, C-terminal, alpha helical domain of GTT2-like Glutathione S-transferases Back     alignment and domain information
>gnl|CDD|239345 cd03047, GST_N_2, GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>gnl|CDD|198288 cd03178, GST_C_Ure2p_like, C-terminal, alpha helical domain of Ure2p and related Glutathione S-transferase-like proteins Back     alignment and domain information
>gnl|CDD|239346 cd03048, GST_N_Ure2p_like, GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>gnl|CDD|223512 COG0435, ECM4, Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|183298 PRK11752, PRK11752, putative S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|222110 pfam13409, GST_N_2, Glutathione S-transferase, N-terminal domain Back     alignment and domain information
>gnl|CDD|185068 PRK15113, PRK15113, glutathione S-transferase; Provisional Back     alignment and domain information
>gnl|CDD|173353 PTZ00057, PTZ00057, glutathione s-transferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 142
PLN02395215 glutathione S-transferase 99.96
PRK09481211 sspA stringent starvation protein A; Provisional 99.96
PRK10542201 glutathionine S-transferase; Provisional 99.96
PLN02473214 glutathione S-transferase 99.96
TIGR01262210 maiA maleylacetoacetate isomerase. Maleylacetoacet 99.95
PRK13972215 GSH-dependent disulfide bond oxidoreductase; Provi 99.95
COG0625211 Gst Glutathione S-transferase [Posttranslational m 99.95
KOG0868|consensus217 99.94
PRK15113214 glutathione S-transferase; Provisional 99.94
PRK10357202 putative glutathione S-transferase; Provisional 99.94
PRK11752264 putative S-transferase; Provisional 99.93
KOG0406|consensus231 99.93
KOG0867|consensus226 99.93
PTZ00057205 glutathione s-transferase; Provisional 99.93
TIGR00862236 O-ClC intracellular chloride channel protein. Thes 99.9
PLN02378213 glutathione S-transferase DHAR1 99.89
KOG1695|consensus206 99.89
PRK10387210 glutaredoxin 2; Provisional 99.88
PLN02817265 glutathione dehydrogenase (ascorbate) 99.88
TIGR02182209 GRXB Glutaredoxin, GrxB family. This model include 99.86
PLN02907 722 glutamate-tRNA ligase 99.85
KOG4420|consensus325 99.74
cd03189119 GST_C_GTT1_like GST_C family, Saccharomyces cerevi 99.66
cd03177118 GST_C_Delta_Epsilon GST_C family, Class Delta and 99.64
cd03196115 GST_C_5 GST_C family, unknown subfamily 5; compose 99.63
cd03188114 GST_C_Beta GST_C family, Class Beta subfamily; GST 99.63
cd03182117 GST_C_GTT2_like GST_C family, Saccharomyces cerevi 99.62
cd03180110 GST_C_2 GST_C family, unknown subfamily 2; compose 99.6
cd03179105 GST_C_1 GST_C family, unknown subfamily 1; compose 99.6
cd03191121 GST_C_Zeta GST_C family, Class Zeta subfamily; GST 99.59
cd0320096 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed 99.59
cd03186107 GST_C_SspA GST_N family, Stringent starvation prot 99.59
KOG1422|consensus221 99.57
cd03178113 GST_C_Ure2p_like GST_C family, Ure2p-like subfamil 99.57
cd03187118 GST_C_Phi GST_C family, Class Phi subfamily; compo 99.55
PF1341069 GST_C_2: Glutathione S-transferase, C-terminal dom 99.55
KOG3027|consensus257 99.54
KOG4244|consensus281 99.52
cd03185126 GST_C_Tau GST_C family, Class Tau subfamily; GSTs 99.52
cd03190142 GST_C_ECM4_like GST_C family, ECM4-like subfamily; 99.51
cd03192104 GST_C_Sigma_like GST_C family, Class Sigma_like; c 99.5
PF0004395 GST_C: Glutathione S-transferase, C-terminal domai 99.49
cd00299100 GST_C_family Glutathione S-transferase (GST) famil 99.49
cd03181123 GST_C_EFB1gamma GST_C family, Gamma subunit of Elo 99.48
cd03206100 GST_C_7 GST_C family, unknown subfamily 7; compose 99.47
cd03183126 GST_C_Theta GST_C family, Class Theta subfamily; c 99.47
cd03209121 GST_C_Mu GST_C family, Class Mu subfamily; GSTs ar 99.46
cd03184124 GST_C_Omega GST_C family, Class Omega subfamily; G 99.45
PF1449799 GST_C_3: Glutathione S-transferase, C-terminal dom 99.42
cd03202124 GST_C_etherase_LigE GST_C family, Beta etherase Li 99.41
cd03207103 GST_C_8 GST_C family, unknown subfamily 8; compose 99.41
cd03208137 GST_C_Alpha GST_C family, Class Alpha subfamily; G 99.4
cd03210126 GST_C_Pi GST_C family, Class Pi subfamily; GSTs ar 99.38
cd03198134 GST_C_CLIC GST_C family, Chloride Intracellular Ch 99.37
cd03204111 GST_C_GDAP1 GST_C family, Ganglioside-induced diff 99.35
cd0319388 GST_C_Metaxin GST_C family, Metaxin subfamily; com 99.33
cd03195114 GST_C_4 GST_C family, unknown subfamily 4; compose 99.33
cd03203120 GST_C_Lambda GST_C family, Class Lambda subfamily; 99.29
COG0435324 ECM4 Predicted glutathione S-transferase [Posttran 99.27
cd03211126 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Me 99.22
KOG2903|consensus319 99.22
cd0320598 GST_C_6 GST_C family, unknown subfamily 6; compose 99.18
cd03197149 GST_C_mPGES2 GST_C family; microsomal Prostaglandi 99.17
KOG3028|consensus313 99.17
cd03201121 GST_C_DHAR GST_C family, Dehydroascorbate Reductas 99.15
cd03194114 GST_C_3 GST_C family, unknown subfamily 3; compose 99.15
COG2999215 GrxB Glutaredoxin 2 [Posttranslational modificatio 99.09
cd03212137 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, 99.07
PF1341775 GST_N_3: Glutathione S-transferase, N-terminal dom 99.06
KOG3029|consensus370 99.05
cd0306191 GST_N_CLIC GST_N family, Chloride Intracellular Ch 99.02
cd0304676 GST_N_GTT1_like GST_N family, Saccharomyces cerevi 99.02
cd0308075 GST_N_Metaxin_like GST_N family, Metaxin subfamily 99.01
cd0305076 GST_N_Theta GST_N family, Class Theta subfamily; c 99.0
cd0305273 GST_N_GDAP1 GST_N family, Ganglioside-induced diff 99.0
cd0305777 GST_N_Beta GST_N family, Class Beta subfamily; GST 98.99
cd0307582 GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar 98.99
cd0307673 GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar 98.98
cd0304881 GST_N_Ure2p_like GST_N family, Ure2p-like subfamil 98.97
cd0307779 GST_N_Alpha GST_N family, Class Alpha subfamily; G 98.97
cd0303884 GST_N_etherase_LigE GST_N family, Beta etherase Li 98.93
cd0305973 GST_N_SspA GST_N family, Stringent starvation prot 98.93
cd0303972 GST_N_Sigma_like GST_N family, Class Sigma_like; c 98.89
cd0305376 GST_N_Phi GST_N family, Class Phi subfamily; compo 98.89
PF1340970 GST_N_2: Glutathione S-transferase, N-terminal dom 98.88
PF0279876 GST_N: Glutathione S-transferase, N-terminal domai 98.88
cd0304574 GST_N_Delta_Epsilon GST_N family, Class Delta and 98.87
cd0304773 GST_N_2 GST_N family, unknown subfamily 2; compose 98.86
cd0305874 GST_N_Tau GST_N family, Class Tau subfamily; GSTs 98.84
cd0307974 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me 98.83
cd0304177 GST_N_2GST_N GST_N family, 2 repeats of the N-term 98.82
cd0304373 GST_N_1 GST_N family, unknown subfamily 1; compose 98.8
cd0304475 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo 98.76
cd0304273 GST_N_Zeta GST_N family, Class Zeta subfamily; GST 98.74
cd0305673 GST_N_4 GST_N family, unknown subfamily 4; compose 98.73
cd0305472 GST_N_Metaxin GST_N family, Metaxin subfamily; com 98.68
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 98.65
cd0304077 GST_N_mPGES2 GST_N family; microsomal Prostaglandi 98.63
cd0303771 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub 98.59
cd0304973 GST_N_3 GST_N family, unknown subfamily 3; compose 98.58
cd0305174 GST_N_GTT2_like GST_N family, Saccharomyces cerevi 98.56
cd0057071 GST_N_family Glutathione S-transferase (GST) famil 98.33
PF14834117 GST_C_4: Glutathione S-transferase, C-terminal dom 98.25
cd0307873 GST_N_Metaxin1_like GST_N family, Metaxin subfamil 98.19
KOG1147|consensus 712 97.87
PF04399132 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain 97.7
PF1056872 Tom37: Outer mitochondrial membrane transport comp 97.46
cd03199128 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) sub 97.2
PF11801168 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019 95.59
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 94.55
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 92.65
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 87.95
PRK1063883 glutaredoxin 3; Provisional 87.45
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 86.37
PRK1120085 grxA glutaredoxin 1; Provisional 85.85
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 84.28
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 81.98
PF09635122 MetRS-N: MetRS-N binding domain; InterPro: IPR0182 81.31
>PLN02395 glutathione S-transferase Back     alignment and domain information
Probab=99.96  E-value=2.8e-28  Score=162.44  Aligned_cols=141  Identities=21%  Similarity=0.403  Sum_probs=111.0

Q ss_pred             CCCCCCCCeeeeCCEEeeehHHHHHHHHhhcCCC-CCCCCcccHHHHHHHHHHHhhhccccchhhhHhHhhhh-----h-
Q psy7998           1 MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMN-SSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMV-----Y-   73 (142)
Q Consensus         1 ~nP~g~vP~L~~~~~~l~es~~I~~yl~~~~~~~-~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-----~-   73 (142)
                      +||.|+||+|+++|.+|+||.+|++||+++++.. +. ++|.++.+++++++|+.+....+.+.+........     . 
T Consensus        47 ~nP~g~vP~L~~~~~~l~ES~aI~~YL~~~~~~~~~~-l~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  125 (215)
T PLN02395         47 LQPFGVVPVIVDGDYKIFESRAIMRYYAEKYRSQGPD-LLGKTIEERGQVEQWLDVEATSYHPPLLNLTLHILFASKMGF  125 (215)
T ss_pred             hCCCCCCCEEEECCEEEEcHHHHHHHHHHHcCCCCcC-cCCCChhHHHHHHHHHHHHHHhcCchHHHHHHHHHhhhhccC
Confidence            5999999999999999999999999999999743 35 89999999999999999888776655433221111     1 


Q ss_pred             cCcccchHHHHHHHHHHHHHHHhhccCCceeccCCccHHHHHHHHHHHHHhhhCC---CccccHHHHHhHhC
Q psy7998          74 EGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLP---EVESYWKIQAWIKR  142 (142)
Q Consensus        74 ~~~~~~~~~~~~~~~~~l~~le~~L~~~~fl~G~~~s~aD~~~~~~l~~~~~~~~---~~~~~p~l~~~~~r  142 (142)
                      ....+..+...+.+.+.++.||++|++++|++|+++|+||+++++++.++....+   .+..||+|.+|++|
T Consensus       126 ~~~~~~~~~~~~~~~~~l~~le~~L~~~~~l~G~~~s~ADi~l~~~~~~~~~~~~~~~~~~~~p~L~~w~~~  197 (215)
T PLN02395        126 PADEKVIKESEEKLAKVLDVYEARLSKSKYLAGDFVSLADLAHLPFTEYLVGPIGKAYLIKDRKHVSAWWDD  197 (215)
T ss_pred             CCcHHHHHHHHHHHHHHHHHHHHHhcCCccccCCCcCHHHHHHHHHHHHHhcccchhhhhccCchHHHHHHH
Confidence            1112233556778899999999999988999999999999999998887633222   36789999999975



>PRK09481 sspA stringent starvation protein A; Provisional Back     alignment and domain information
>PRK10542 glutathionine S-transferase; Provisional Back     alignment and domain information
>PLN02473 glutathione S-transferase Back     alignment and domain information
>TIGR01262 maiA maleylacetoacetate isomerase Back     alignment and domain information
>PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional Back     alignment and domain information
>COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0868|consensus Back     alignment and domain information
>PRK15113 glutathione S-transferase; Provisional Back     alignment and domain information
>PRK10357 putative glutathione S-transferase; Provisional Back     alignment and domain information
>PRK11752 putative S-transferase; Provisional Back     alignment and domain information
>KOG0406|consensus Back     alignment and domain information
>KOG0867|consensus Back     alignment and domain information
>PTZ00057 glutathione s-transferase; Provisional Back     alignment and domain information
>TIGR00862 O-ClC intracellular chloride channel protein Back     alignment and domain information
>PLN02378 glutathione S-transferase DHAR1 Back     alignment and domain information
>KOG1695|consensus Back     alignment and domain information
>PRK10387 glutaredoxin 2; Provisional Back     alignment and domain information
>PLN02817 glutathione dehydrogenase (ascorbate) Back     alignment and domain information
>TIGR02182 GRXB Glutaredoxin, GrxB family Back     alignment and domain information
>PLN02907 glutamate-tRNA ligase Back     alignment and domain information
>KOG4420|consensus Back     alignment and domain information
>cd03189 GST_C_GTT1_like GST_C family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03182 GST_C_GTT2_like GST_C family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03179 GST_C_1 GST_C family, unknown subfamily 1; composed of uncharacterized bacterial proteins, with similarity to GSTs Back     alignment and domain information
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene Back     alignment and domain information
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>KOG1422|consensus Back     alignment and domain information
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>PF13410 GST_C_2: Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B Back     alignment and domain information
>KOG3027|consensus Back     alignment and domain information
>KOG4244|consensus Back     alignment and domain information
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4 Back     alignment and domain information
>cd03192 GST_C_Sigma_like GST_C family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi, and Alpha Back     alignment and domain information
>PF00043 GST_C: Glutathione S-transferase, C-terminal domain; InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd00299 GST_C_family Glutathione S-transferase (GST) family, C-terminal alpha helical domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF14497 GST_C_3: Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B Back     alignment and domain information
>cd03202 GST_C_etherase_LigE GST_C family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress Back     alignment and domain information
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins Back     alignment and domain information
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs Back     alignment and domain information
>COG0435 ECM4 Predicted glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03211 GST_C_Metaxin2 GST_C family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>KOG2903|consensus Back     alignment and domain information
>cd03205 GST_C_6 GST_C family, unknown subfamily 6; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03197 GST_C_mPGES2 GST_C family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>KOG3028|consensus Back     alignment and domain information
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant Back     alignment and domain information
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs Back     alignment and domain information
>COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03212 GST_C_Metaxin1_3 GST_C family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins Back     alignment and domain information
>PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A Back     alignment and domain information
>KOG3029|consensus Back     alignment and domain information
>cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins Back     alignment and domain information
>cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs Back     alignment and domain information
>cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase Back     alignment and domain information
>cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells Back     alignment and domain information
>cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs Back     alignment and domain information
>cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor Back     alignment and domain information
>cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E Back     alignment and domain information
>cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha Back     alignment and domain information
>cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins Back     alignment and domain information
>PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B Back     alignment and domain information
>PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione Back     alignment and domain information
>cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait Back     alignment and domain information
>cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins Back     alignment and domain information
>cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs Back     alignment and domain information
>cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis Back     alignment and domain information
>cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 Back     alignment and domain information
>cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs Back     alignment and domain information
>cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S Back     alignment and domain information
>cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress Back     alignment and domain information
>PF14834 GST_C_4: Glutathione S-transferase, C-terminal domain; PDB: 3BBY_A Back     alignment and domain information
>cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi Back     alignment and domain information
>KOG1147|consensus Back     alignment and domain information
>PF04399 Glutaredoxin2_C: Glutaredoxin 2, C terminal domain; InterPro: IPR007494 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>cd03199 GST_C_GRX2 GST_C family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E Back     alignment and domain information
>PF11801 Tom37_C: Tom37 C-terminal domain; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>PF09635 MetRS-N: MetRS-N binding domain; InterPro: IPR018285 This entry represents the N-terminal domain of methionyl-tRNA synthetase (MetRS) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
4hi7_A228 Crystal Structure Of Glutathione Transferase Homolo 6e-26
3vwx_A222 Structural Analysis Of An Epsilon-class Glutathione 1e-23
2il3_A221 Structures Of An Insect Epsilon-Class Glutathione S 8e-22
1jlv_A209 Anopheles Dirus Species B Glutathione S-transferase 2e-21
1r5a_A218 Glutathione S-Transferase Length = 218 3e-21
3ay8_A216 Glutathione S-Transferase Unclassified 2 From Bomby 2e-20
3ein_A209 Delta Class Gst Length = 209 7e-19
1pn9_A209 Crystal Structure Of An Insect Delta-class Glutathi 9e-19
3vk9_A216 Crystal Structure Of Delta-Class Glutathione Transf 2e-18
1v2a_A210 Glutathione S-transferase 1-6 From Anopheles Dirus 4e-15
3f6f_A210 Crystal Structure Of Glutathione Transferase Dmgstd 6e-15
3g7j_A219 Crystal Structure Of A Genetically Modified Delta C 1e-13
1jlw_A219 Anopheles Dirus Species B Glutathione S-Transferase 2e-13
3f6d_A219 Crystal Structure Of A Genetically Modified Delta C 5e-13
2c3n_A247 Human Glutathione-S-Transferase T1-1, Apo Form Leng 3e-07
2c3q_A247 Human Glutathione-S-Transferase T1-1 W234r Mutant, 3e-07
1ljr_A244 Glutathione Transferase (Hgst T2-2) From Human Leng 3e-06
1fw1_A216 Glutathione Transferase ZetaMALEYLACETOACETATE ISOM 2e-05
3c8e_A288 Crystal Structure Analysis Of Yghu From E. Coli Len 4e-05
1aw9_A216 Structure Of Glutathione S-Transferase Iii In Apo F 4e-05
3m3m_A210 Crystal Structure Of Glutathione S-Transferase From 5e-05
4iel_A229 Crystal Structure Of A Glutathione S-Transferase Fa 6e-05
3m8n_A225 Crystal Structure Of A Possible Gutathione S-Tranfe 6e-05
1e6b_A221 Crystal Structure Of A Zeta Class Glutathione S-Tra 1e-04
1gnw_A211 Structure Of Glutathione S-Transferase Length = 211 2e-04
2cz2_A223 Crystal Structure Of Glutathione Transferase Zeta 1 2e-04
3qav_A243 Crystal Structure Of A Glutathione S-transferase Fr 4e-04
1ev9_A221 Rat Glutathione S-Transferase A1-1 Mutant W21f With 4e-04
1ev4_A221 Rat Glutathione S-transferase A1-1: Mutant W21f/f22 4e-04
3lsz_A225 Crystal Structure Of Glutathione S-Transferase From 5e-04
1axd_A209 Structure Of Glutathione S-transferase-i Bound With 5e-04
1bye_A213 Glutathione S-Transferase I From Mais In Complex Wi 5e-04
1gwc_A230 The Structure Of A Tau Class Glutathione S-Transfer 5e-04
1f3a_A222 Crystal Structure Of Mgsta1-1 In Complex With Gsh L 8e-04
1f3b_A222 Crystal Structure Of Mgsta1-1 In Complex With Gluta 8e-04
>pdb|4HI7|A Chain A, Crystal Structure Of Glutathione Transferase Homolog From Drosophilia Mojavensis, Target Efi-501819, With Bound Glutathione Length = 228 Back     alignment and structure

Iteration: 1

Score = 112 bits (281), Expect = 6e-26, Method: Compositional matrix adjust. Identities = 58/143 (40%), Positives = 90/143 (62%), Gaps = 3/143 (2%) Query: 2 NPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLF 61 NP VP+L D I+DSHAI+ YL S+YG + S LYP+DL KRA+VD+R++F++GV+F Sbjct: 50 NPQHTVPLLEDGDANIADSHAIMAYLVSKYGKDDS-LYPKDLVKRALVDNRMYFESGVVF 108 Query: 62 P-SLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFXXXXXX 120 +L ++ + +++ G+T + +++ EA DFVE K +VAG+++T+ADF Sbjct: 109 ANALRSLAKMILFLGKTEVPQERIDAITEAYDFVEAFFKDQTYVAGNQLTIADFSLISSI 168 Query: 121 XXXXXXXP-EVESYWKIQAWIKR 142 P + Y K+ AWIKR Sbjct: 169 SSLVAFVPVDAAKYPKLSAWIKR 191
>pdb|3VWX|A Chain A, Structural Analysis Of An Epsilon-class Glutathione S-transferase From Housefly, Musca Domestica Length = 222 Back     alignment and structure
>pdb|2IL3|A Chain A, Structures Of An Insect Epsilon-Class Glutathione S- Transferase From The Malaria Vector Anopheles Gambiae: Evidence For High Ddt-Detoxifying Activity Length = 221 Back     alignment and structure
>pdb|1JLV|A Chain A, Anopheles Dirus Species B Glutathione S-transferases 1-3 Length = 209 Back     alignment and structure
>pdb|1R5A|A Chain A, Glutathione S-Transferase Length = 218 Back     alignment and structure
>pdb|3AY8|A Chain A, Glutathione S-Transferase Unclassified 2 From Bombyx Mori Length = 216 Back     alignment and structure
>pdb|3EIN|A Chain A, Delta Class Gst Length = 209 Back     alignment and structure
>pdb|1PN9|A Chain A, Crystal Structure Of An Insect Delta-class Glutathione S- Transferase From A Ddt-resistant Strain Of The Malaria Vector Anopheles Gambiae Length = 209 Back     alignment and structure
>pdb|3VK9|A Chain A, Crystal Structure Of Delta-Class Glutathione Transferase From Silkmoth Length = 216 Back     alignment and structure
>pdb|1V2A|A Chain A, Glutathione S-transferase 1-6 From Anopheles Dirus Species B Length = 210 Back     alignment and structure
>pdb|3F6F|A Chain A, Crystal Structure Of Glutathione Transferase Dmgstd10 From Drosophila Melanogaster Length = 210 Back     alignment and structure
>pdb|3G7J|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (adgstd4- 4) From Anopheles Dirus, Y119e, In Complex With S-hexyl Glutathione Length = 219 Back     alignment and structure
>pdb|1JLW|A Chain A, Anopheles Dirus Species B Glutathione S-Transferases 1-4 Length = 219 Back     alignment and structure
>pdb|3F6D|A Chain A, Crystal Structure Of A Genetically Modified Delta Class Gst (Adgstd4- 4) From Anopheles Dirus, F123a, In Complex With S-Hexyl Glutathione Length = 219 Back     alignment and structure
>pdb|2C3N|A Chain A, Human Glutathione-S-Transferase T1-1, Apo Form Length = 247 Back     alignment and structure
>pdb|2C3Q|A Chain A, Human Glutathione-S-Transferase T1-1 W234r Mutant, Complex With S-Hexylglutathione Length = 247 Back     alignment and structure
>pdb|1LJR|A Chain A, Glutathione Transferase (Hgst T2-2) From Human Length = 244 Back     alignment and structure
>pdb|1FW1|A Chain A, Glutathione Transferase ZetaMALEYLACETOACETATE ISOMERASE Length = 216 Back     alignment and structure
>pdb|3C8E|A Chain A, Crystal Structure Analysis Of Yghu From E. Coli Length = 288 Back     alignment and structure
>pdb|1AW9|A Chain A, Structure Of Glutathione S-Transferase Iii In Apo Form Length = 216 Back     alignment and structure
>pdb|3M3M|A Chain A, Crystal Structure Of Glutathione S-Transferase From Pseudomonas Fluorescens [pf-5] Length = 210 Back     alignment and structure
>pdb|4IEL|A Chain A, Crystal Structure Of A Glutathione S-Transferase Family Protein From Burkholderia Ambifaria, Target Efi-507141, With Bound Glutathione Length = 229 Back     alignment and structure
>pdb|3M8N|A Chain A, Crystal Structure Of A Possible Gutathione S-Tranferase From Rhodopseudomonas Palustris Length = 225 Back     alignment and structure
>pdb|1E6B|A Chain A, Crystal Structure Of A Zeta Class Glutathione S-Transferase From Arabidopsis Thaliana Length = 221 Back     alignment and structure
>pdb|1GNW|A Chain A, Structure Of Glutathione S-Transferase Length = 211 Back     alignment and structure
>pdb|2CZ2|A Chain A, Crystal Structure Of Glutathione Transferase Zeta 1-1 (Maleylacetoacetate Isomerase) From Mus Musculus (Form-1 Crystal) Length = 223 Back     alignment and structure
>pdb|3QAV|A Chain A, Crystal Structure Of A Glutathione S-transferase From Antarctic Clam Laternula Elliptica Length = 243 Back     alignment and structure
>pdb|1EV9|A Chain A, Rat Glutathione S-Transferase A1-1 Mutant W21f With Gso3 Bound Length = 221 Back     alignment and structure
>pdb|1EV4|A Chain A, Rat Glutathione S-transferase A1-1: Mutant W21f/f220y With Gso3 Bound Length = 221 Back     alignment and structure
>pdb|3LSZ|A Chain A, Crystal Structure Of Glutathione S-Transferase From Rhodobacter Sphaeroides Length = 225 Back     alignment and structure
>pdb|1AXD|A Chain A, Structure Of Glutathione S-transferase-i Bound With The Ligand Lactoylglutathione Length = 209 Back     alignment and structure
>pdb|1BYE|A Chain A, Glutathione S-Transferase I From Mais In Complex With Atrazine Glutathione Conjugate Length = 213 Back     alignment and structure
>pdb|1GWC|A Chain A, The Structure Of A Tau Class Glutathione S-Transferase From Wheat, Active In Herbicide Detoxification Length = 230 Back     alignment and structure
>pdb|1F3A|A Chain A, Crystal Structure Of Mgsta1-1 In Complex With Gsh Length = 222 Back     alignment and structure
>pdb|1F3B|A Chain A, Crystal Structure Of Mgsta1-1 In Complex With Glutathione Conjugate Of Benzo[a]pyrene Epoxide Length = 222 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query142
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 1e-54
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 4e-54
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 7e-53
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 3e-52
1r5a_A218 Glutathione transferase; glutathione S-transferase 1e-51
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 4e-51
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 2e-46
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 2e-45
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 4e-45
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 4e-40
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 1e-37
1axd_A209 Glutathione S-transferase I; transferase, herbicid 1e-37
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 7e-37
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 2e-35
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 7e-35
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 3e-33
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 1e-31
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 3e-30
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 5e-28
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 9e-27
3niv_A222 Glutathione S-transferase; structural genomics, PS 1e-26
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 2e-26
3lxz_A229 Glutathione S-transferase family protein; structur 6e-26
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 1e-25
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 2e-24
3n5o_A235 Glutathione transferase; seattle structural genomi 6e-24
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 7e-23
3tou_A226 Glutathione S-transferase protein; GSH binding sit 1e-22
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 2e-22
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 7e-22
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 1e-21
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 2e-21
4exj_A238 Uncharacterized protein; transferase-like protein, 4e-21
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 1e-20
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 1e-20
4g9h_A211 Glutathione S-transferase; GST, enzyme function in 4e-20
3lyk_A216 Stringent starvation protein A homolog; structural 5e-20
3lyp_A215 Stringent starvation protein A; structural genomic 6e-20
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 8e-20
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 3e-19
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 2e-17
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 3e-17
1f2e_A201 Glutathione S-transferase; GST complexed with glut 3e-17
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 5e-17
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 5e-17
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 5e-17
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 6e-17
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 1e-16
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 2e-16
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 2e-16
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 2e-16
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 2e-16
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 2e-16
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 2e-16
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 3e-16
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 3e-16
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 3e-16
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 4e-16
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 5e-16
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 5e-16
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 8e-16
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 1e-15
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 2e-15
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 2e-15
2fhe_A216 GST, glutathione S-transferase; transferase-substr 2e-15
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 4e-15
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 5e-15
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 7e-15
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 1e-14
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 1e-14
4dej_A231 Glutathione S-transferase related protein; transfe 1e-14
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 2e-14
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 4e-14
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 4e-14
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 7e-14
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 9e-14
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 1e-13
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 2e-13
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 4e-12
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 6e-12
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 4e-11
2ahe_A267 Chloride intracellular channel protein 4; glutathi 7e-12
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 5e-11
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 6e-11
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 8e-11
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 4e-10
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 4e-10
2r4v_A247 XAP121, chloride intracellular channel protein 2; 4e-10
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 6e-09
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 7e-09
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 8e-09
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 1e-07
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 1e-07
4ecj_A244 Glutathione S-transferase; transferase-like protei 2e-06
3r3e_A328 Uncharacterized protein YQJG; thioredoxin domain, 6e-04
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 7e-04
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Length = 216 Back     alignment and structure
 Score =  169 bits (431), Expect = 1e-54
 Identities = 53/142 (37%), Positives = 86/142 (60%), Gaps = 1/142 (0%)

Query: 1   MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVL 60
           +NP   VP L+DN   + +S AI  YL  +YG +    YP+DL+KRA+V+ RL+FD+  L
Sbjct: 49  LNPQHCVPTLDDNNFVLWESRAIACYLADKYGKDD-QWYPKDLQKRAVVNQRLYFDSASL 107

Query: 61  FPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATV 120
           +  +  I  P+++ G+T I +  K      L F+   L++T+WVA D  T+AD S+ A++
Sbjct: 108 YVKIRAICFPILFLGETEIKQSLKDDLNSTLSFLNQFLEKTKWVAADHPTIADTSIYASM 167

Query: 121 TSLATLLPEVESYWKIQAWIKR 142
           +S+  +  ++ S+  IQ WIK 
Sbjct: 168 SSILAVGWDISSFPNIQRWIKD 189


>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Length = 221 Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Length = 209 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Length = 209 Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Length = 218 Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Length = 210 Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Length = 219 Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Length = 247 Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Length = 244 Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Length = 243 Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Length = 211 Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Length = 209 Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Length = 221 Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Length = 223 Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Length = 233 Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Length = 214 Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Length = 215 Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Length = 219 Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Length = 216 Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Length = 225 Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Length = 222 Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Length = 242 Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Length = 229 Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Length = 225 Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Length = 174 Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Length = 235 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Length = 213 Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Length = 226 Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Length = 201 Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Length = 214 Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Length = 203 Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Length = 203 Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Length = 238 Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Length = 207 Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Length = 230 Back     alignment and structure
>4g9h_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 2.10A {Yersinia pestis} Length = 211 Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Length = 216 Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Length = 215 Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Length = 202 Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Length = 213 Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Length = 230 Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Length = 210 Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Length = 201 Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Length = 208 Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Length = 227 Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Length = 229 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Length = 218 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Length = 210 Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Length = 206 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Length = 206 Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Length = 221 Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Length = 219 Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Length = 234 Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Length = 224 Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Length = 222 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Length = 206 Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Length = 254 Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Length = 207 Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Length = 218 Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Length = 280 Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Length = 239 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Length = 225 Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Length = 204 Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Length = 249 Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Length = 216 Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Length = 221 Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Length = 201 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Length = 198 Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Length = 208 Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Length = 202 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Length = 231 Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Length = 211 Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Length = 211 Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Length = 211 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Length = 248 Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Length = 252 Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Length = 241 Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Length = 219 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Length = 246 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Length = 471 Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Length = 267 Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Length = 241 Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Length = 260 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Length = 250 Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Length = 231 Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Length = 310 Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Length = 247 Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Length = 260 Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Length = 218 Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Length = 288 Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Length = 215 Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Length = 291 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Length = 244 Back     alignment and structure
>3r3e_A Uncharacterized protein YQJG; thioredoxin domain, GST, glutathione transferase, glutathion disulfide bond reductase, transferase; HET: GSH; 2.21A {Escherichia coli} Length = 328 Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Length = 352 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
3vk9_A216 Glutathione S-transferase delta; glutathione bindi 100.0
4hi7_A228 GI20122; GST, glutathione S-transferase, enzyme fu 99.98
3ein_A209 GST class-theta, glutathione S-transferase 1-1; de 99.97
2imi_A221 Epsilon-class glutathione S-transferase; HET: GSH; 99.97
3ay8_A216 Glutathione S-transferase; GST fold, GST binding, 99.97
1r5a_A218 Glutathione transferase; glutathione S-transferase 99.97
1pn9_A209 GST class-delta, glutathione S-transferase 1-6; pr 99.97
4gci_A211 Glutathione S-transferase; GST, enzyme function in 99.97
1v2a_A210 Glutathione transferase GST1-6; glutathione S-tran 99.97
4gf0_A215 Glutathione S-transferase; GST, enzyme function in 99.97
4glt_A225 Glutathione S-transferase-like protein; structural 99.97
3f6d_A219 Adgstd4-4, glutathione transferase GST1-4; HET: GT 99.97
2x64_A207 Glutathione-S-transferase; detoxification enzyme; 99.97
4hz4_A217 Glutathione-S-transferase; enzyme function initiat 99.97
4hoj_A210 REGF protein; GST, glutathione S-transferase, enzy 99.97
3lyp_A215 Stringent starvation protein A; structural genomic 99.97
4iel_A229 Glutathione S-transferase, N-terminal domain PROT; 99.97
3niv_A222 Glutathione S-transferase; structural genomics, PS 99.97
1n2a_A201 Glutathione S-transferase; HET: GTS; 1.90A {Escher 99.97
3lsz_A225 Glutathione S-transferase; xenobiotic, biodegradat 99.96
3lxz_A229 Glutathione S-transferase family protein; structur 99.96
3n5o_A235 Glutathione transferase; seattle structural genomi 99.96
1gnw_A211 Glutathione S-transferase; herbicide detoxificatio 99.96
2pvq_A201 Glutathione S-transferase; xenobiotics detoxificat 99.96
3lyk_A216 Stringent starvation protein A homolog; structural 99.96
2dsa_A203 Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu 99.96
1pmt_A203 PMGST, GST B1-1, glutathione transferase; glutathi 99.96
2cz2_A223 Maleylacetoacetate isomerase; structural genomics, 99.96
3ibh_A233 GST-II, saccharomyces cerevisiae GTT2; glutathione 99.96
3tou_A226 Glutathione S-transferase protein; GSH binding sit 99.96
2v6k_A214 Maleylpyruvate isomerase; glutathione-S-transferas 99.96
1f2e_A201 Glutathione S-transferase; GST complexed with glut 99.96
3m0f_A213 Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu 99.96
1axd_A209 Glutathione S-transferase I; transferase, herbicid 99.96
3r2q_A202 Uncharacterized GST-like protein YIBF; transferase 99.96
3ubk_A242 Glutathione transferase; GSH binding; 1.95A {Lepto 99.96
3uar_A227 Glutathione S-transferase; GSH binding site; HET: 99.96
1e6b_A221 Glutathione S-transferase; 1.65A {Arabidopsis thal 99.96
2on7_A206 Nagst-1, Na glutathione S-transferase 1; hookworm; 99.96
1zl9_A207 GST class-sigma, glutathione S-transferase 5; glut 99.96
1yy7_A213 SSPA, stringent starvation protein A; GST fold, tr 99.96
2c3n_A247 Glutathione S-transferase theta 1; glutathione tra 99.96
3gx0_A215 GST-like protein YFCG; transferase, glutathione, g 99.96
1ljr_A244 HGST T2-2, glutathione S-transferase; HET: GSH; 3. 99.96
2gsq_A202 Squid GST, glutathione S-transferase; squid digest 99.96
3cbu_A214 Probable GST-related protein; thioredoxin fold, GS 99.96
3qav_A243 RHO-class glutathione S-transferase; cytosol; 2.10 99.96
1nhy_A219 EF-1-gamma 1, elongation factor 1-gamma 1; protein 99.96
3iso_A218 Putative glutathione transferase; GST; HET: GSH; 1 99.96
3m8n_A225 Possible glutathione S-transferase; PSI-II, struct 99.96
1tu7_A208 Glutathione S-transferase 2; HET: GSH; 1.50A {Onch 99.96
4hz2_A230 Glutathione S-transferase domain; glutathione,enzy 99.96
1tw9_A206 Glutathione S-transferase 2; 1.71A {Heligmosomoide 99.96
2on5_A206 Nagst-2, Na glutathione S-transferase 2; hookworm; 99.96
4exj_A238 Uncharacterized protein; transferase-like protein, 99.96
1aw9_A216 Glutathione S-transferase III; herbicide detoxific 99.96
3m3m_A210 Glutathione S-transferase; PSI-II, structural geno 99.95
2vo4_A219 2,4-D inducible glutathione S-transferase; herbici 99.95
3gtu_B224 Glutathione S-transferase; conjugation, detoxifica 99.95
2cvd_A198 Glutathione-requiring prostaglandin D synthase; gl 99.95
2a2r_A210 Glutathione S-transferase P; detoxification, nitri 99.95
1gwc_A230 Glutathione S-transferase TSI-1; herbicide detoxif 99.95
4dej_A231 Glutathione S-transferase related protein; transfe 99.95
1k3y_A221 GSTA1-1, glutathione S-transferase A1; S-hexyl glu 99.95
3q18_A239 GSTO-2, glutathione S-transferase omega-2; glutath 99.95
3vln_A241 GSTO-1, glutathione S-transferase omega-1; GST fol 99.95
2ycd_A230 Glutathione S-transferase; SOIL bacteria, herbicid 99.95
1yq1_A208 Glutathione S-transferase; nematoda, structural ge 99.95
2fhe_A216 GST, glutathione S-transferase; transferase-substr 99.95
1b48_A221 GST, mgsta4-4, protein (glutathione S-transferase) 99.95
4ikh_A244 Glutathione S-transferase; enzyme function initiat 99.95
1dug_A234 Chimera of glutathione S-transferase-synthetic lin 99.95
4g10_A265 Glutathione S-transferase homolog; thioredoxin fol 99.95
2wb9_A211 Glutathione transferase sigma class; thioredoxin f 99.95
2uz8_A174 Eukaryotic translation elongation factor 1 epsilon 99.95
1vf1_A229 Glutathione S-transferase 3; detoxification; HET: 99.95
3ik7_A222 Glutathione S-transferase A4; human GST A4-4, enzy 99.95
1m0u_A249 GST2 gene product; flight muscle protein, sigma, t 99.95
2hnl_A225 Glutathione S-transferase 1; prostaglandin synthas 99.95
3bby_A215 Uncharacterized GST-like protein YFCF; NP_416804.1 99.95
1gsu_A219 GST, CGSTM1-1, class-MU glutathione S-transferase; 99.95
1okt_A211 Glutathione S-transferase; GST; 1.9A {Plasmodium f 99.95
4id0_A214 Glutathione S-transferase-like protein YIBF; GST, 99.95
2c4j_A218 Glutathione S-transferase MU 2; glutathione transf 99.95
1oyj_A231 Glutathione S-transferase; herbicide detoxificatio 99.95
4ecj_A244 Glutathione S-transferase; transferase-like protei 99.95
2ws2_A204 NU-class GST, glutathione S-transferase; parasite, 99.95
1oe8_A211 Glutathione S-transferase; schistosomiasis, detoxi 99.95
1b8x_A280 Protein (AML-1B); nuclear matrix targeting signal 99.94
3rbt_A246 Glutathione transferase O1; glutathione S-transfer 99.94
1k0d_A260 URE2 protein; nitrate assimilation, structural gen 99.94
3h1n_A252 Probable glutathione S-transferase; APC84167, bord 99.94
3c8e_A288 YGHU, glutathione S-transferase homologue; glutath 99.93
1k0m_A241 CLIC1, NCC27, chloride intracellular channel prote 99.93
2r4v_A247 XAP121, chloride intracellular channel protein 2; 99.92
3ic8_A310 Uncharacterized GST-like proteinprotein; glutathio 99.92
1bg5_A254 MAB, fusion protein of alpha-Na,K-ATPase with glut 99.92
2fno_A248 AGR_PAT_752P; thioredoxin fold, GST C-terminal dom 99.92
3fy7_A250 Chloride intracellular channel protein 3; GST, glu 99.92
2ahe_A267 Chloride intracellular channel protein 4; glutathi 99.92
4ags_A 471 Thiol-dependent reductase 1; transferase, leishman 99.92
3ir4_A218 Glutaredoxin 2; glutathione, IDP00895, structural 99.91
4ags_A471 Thiol-dependent reductase 1; transferase, leishman 99.91
4f03_A253 Glutathione transferase; GST fold; 1.80A {Phaneroc 99.9
3m1g_A362 Putative glutathione S-transferase; ECM4-like subf 99.9
3ppu_A352 Glutathione-S-transferase; GST fold; HET: GSH; 2.3 99.9
2yv7_A260 CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c 99.89
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 99.89
2yv9_A291 Chloride intracellular channel EXC-4; chloride ION 99.88
4fqu_A313 Putative glutathione transferase; glutathionyl-hyd 99.87
4g0i_A328 Protein YQJG; glutathionyl-hydroquinone reductase, 99.87
1z9h_A290 Membrane-associated prostaglandin E synthase-2; me 99.86
2hra_A209 Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, l 99.81
2hsn_A160 Methionyl-tRNA synthetase, cytoplasmic; protein co 99.71
2hqt_A124 GU4 nucleic-binding protein 1; GST-fold, biosynthe 99.42
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 96.26
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 96.19
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 94.22
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 93.53
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 88.74
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 81.02
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 80.75
>3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} Back     alignment and structure
Probab=100.00  E-value=3.4e-32  Score=180.37  Aligned_cols=139  Identities=40%  Similarity=0.689  Sum_probs=120.1

Q ss_pred             CCCCCCCCeeeeCCEEeeehHHHHHHHHhhcCCCCCCCCcccHHHHHHHHHHHhhhccccchhhhHhHhhhhhcCcccch
Q psy7998           1 MNPLKKVPVLNDNGIYISDSHAILTYLTSQYGMNSSHLYPRDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTIL   80 (142)
Q Consensus         1 ~nP~g~vP~L~~~~~~l~es~~I~~yl~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (142)
                      +||.|+||+|++||.+|+||.+|++||+++++.++. +.|.++.+++.+++|+.+....+.+.+...+.+...... ...
T Consensus        48 ~nP~g~vP~L~d~g~~l~eS~aI~~YL~~~~~~~~~-l~p~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~-~~~  125 (216)
T 3vk9_A           48 LNPQHTVPTLVDDGLSIWESRAIITYLVNKYAKGSS-LYPEDPKARALVDQRLYFDIGTLYQRFSDYFYPQVFAGA-PAD  125 (216)
T ss_dssp             HCTTCCSCEEEETTEEECCHHHHHHHHHHHHCTTCT-TSCCSHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHSCC-CCC
T ss_pred             hCCCCccceEecCCceeechHHHHHHHHHhcCcccC-CCCCCHHHHHHhhhhHHHHhhhhhhHHHHHHHHHHHhcc-hhH
Confidence            599999999999999999999999999999986677 899999999999999999888887777666655544332 233


Q ss_pred             HHHHHHHHHHHHHHHhhccCCceeccCCccHHHHHHHHHHHHHhhhCC-CccccHHHHHhHhC
Q psy7998          81 EDKKKIALEALDFVEGLLKQTEWVAGDKMTVADFSLVATVTSLATLLP-EVESYWKIQAWIKR  142 (142)
Q Consensus        81 ~~~~~~~~~~l~~le~~L~~~~fl~G~~~s~aD~~~~~~l~~~~~~~~-~~~~~p~l~~~~~r  142 (142)
                      ....+.+.+.|+.+|++|++++|++|+++|+|||++++.+.++ ...+ +++.||+|.+|++|
T Consensus       126 ~~~~~~~~~~l~~le~~L~~~~~l~G~~~t~ADi~~~~~l~~~-~~~~~~~~~~P~l~~w~~r  187 (216)
T 3vk9_A          126 KAKNEKVQEALQLLDKFLEGQKYVAGPNLTVADLSLIASVSSL-EASDIDFKKYANVKRWYET  187 (216)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTCSBTTBSSCCHHHHHHHHHHHHG-GGTTCCGGGSHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHhccCCCCCCCCCCHHHHHHHHHHHHH-HHcCCCchhCHHHHHHHHH
Confidence            5567789999999999999999999999999999999999988 4456 78999999999975



>4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} Back     alignment and structure
>3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* Back     alignment and structure
>2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* Back     alignment and structure
>3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} Back     alignment and structure
>1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* Back     alignment and structure
>1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} Back     alignment and structure
>4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} Back     alignment and structure
>3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* Back     alignment and structure
>2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} Back     alignment and structure
>4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} Back     alignment and structure
>4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A Back     alignment and structure
>4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} Back     alignment and structure
>3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} Back     alignment and structure
>1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* Back     alignment and structure
>3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} Back     alignment and structure
>3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* Back     alignment and structure
>3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* Back     alignment and structure
>1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* Back     alignment and structure
>2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* Back     alignment and structure
>3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} Back     alignment and structure
>2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* Back     alignment and structure
>1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* Back     alignment and structure
>2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* Back     alignment and structure
>3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* Back     alignment and structure
>3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* Back     alignment and structure
>2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* Back     alignment and structure
>1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* Back     alignment and structure
>1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* Back     alignment and structure
>3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} Back     alignment and structure
>3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* Back     alignment and structure
>3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* Back     alignment and structure
>1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} Back     alignment and structure
>1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} Back     alignment and structure
>2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A Back     alignment and structure
>3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} Back     alignment and structure
>1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* Back     alignment and structure
>2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* Back     alignment and structure
>3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} Back     alignment and structure
>3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* Back     alignment and structure
>1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} Back     alignment and structure
>3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} Back     alignment and structure
>1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* Back     alignment and structure
>4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} Back     alignment and structure
>1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} Back     alignment and structure
>4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} Back     alignment and structure
>1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} Back     alignment and structure
>2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* Back     alignment and structure
>3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* Back     alignment and structure
>2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... Back     alignment and structure
>1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} Back     alignment and structure
>1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... Back     alignment and structure
>3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* Back     alignment and structure
>3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* Back     alignment and structure
>2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A Back     alignment and structure
>1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} Back     alignment and structure
>2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* Back     alignment and structure
>1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A Back     alignment and structure
>4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} Back     alignment and structure
>1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* Back     alignment and structure
>4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} Back     alignment and structure
>2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* Back     alignment and structure
>2uz8_A Eukaryotic translation elongation factor 1 epsilon-1; protein biosynthesis, aminoacyl-tRNA synthetase, GST, nuclear protein, RNA-binding protein; HET: MSE; 2.0A {Homo sapiens} Back     alignment and structure
>1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A Back     alignment and structure
>3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* Back     alignment and structure
>1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} Back     alignment and structure
>3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} Back     alignment and structure
>1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* Back     alignment and structure
>1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* Back     alignment and structure
>4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* Back     alignment and structure
>2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... Back     alignment and structure
>1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* Back     alignment and structure
>2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} Back     alignment and structure
>1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* Back     alignment and structure
>1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} Back     alignment and structure
>1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A Back     alignment and structure
>3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} Back     alignment and structure
>1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A Back     alignment and structure
>2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* Back     alignment and structure
>3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} Back     alignment and structure
>1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 Back     alignment and structure
>3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A Back     alignment and structure
>2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A Back     alignment and structure
>4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} Back     alignment and structure
>4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* Back     alignment and structure
>3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} Back     alignment and structure
>2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>4fqu_A Putative glutathione transferase; glutathionyl-hydroquinone reductases, oxidoredu; 3.00A {Sphingobium chlorophenolicum} Back     alignment and structure
>4g0i_A Protein YQJG; glutathionyl-hydroquinone reductase, oxidoreductase; HET: MES; 2.05A {Escherichia coli} PDB: 3r3e_A* 4g0k_A* 4g0l_A* Back     alignment and structure
>1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* Back     alignment and structure
>2hra_A Glutamyl-tRNA synthetase, cytoplasmic; GST-fold, ligase; 1.90A {Saccharomyces cerevisiae} PDB: 2hrk_A 2hsm_A Back     alignment and structure
>2hsn_A Methionyl-tRNA synthetase, cytoplasmic; protein complex protein interaction GST-fold, ligase/RNA binding protein complex; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2hqt_A GU4 nucleic-binding protein 1; GST-fold, biosynthetic protein, RNA binding; 1.90A {Saccharomyces cerevisiae} SCOP: a.45.1.2 PDB: 2hrk_B 2hsm_B 2hsn_B Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 142
d1r5aa1129 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Ano 3e-26
d1v2aa1125 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Ano 7e-25
d1jlva1123 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Ano 3e-22
d1jlwa1127 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Ano 9e-21
d1ljra1165 a.45.1.1 (A:80-244) Class theta GST {Human (Homo s 2e-16
d1b48a1143 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus mu 3e-12
d1k0da1151 a.45.1.1 (A:201-351) Yeast prion protein ure2p, ni 6e-12
d1axda1129 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays 9e-12
d1e6ba1133 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cres 1e-11
d1gula1140 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo s 2e-11
d1pmta1121 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabi 2e-11
d1n2aa1121 a.45.1.1 (A:81-201) Class beta GST {Escherichia co 2e-11
d1gnwa1126 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress 1e-10
d1k3ya1142 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo s 2e-10
d1f2ea1121 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas p 7e-10
d1nhya1144 a.45.1.1 (A:76-219) GST-like domain of elongation 2e-09
d1fw1a1125 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sa 3e-09
d2a2ra1132 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapi 2e-08
d1aw9a1135 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays 4e-08
d1z9ha1161 a.45.1.1 (A:213-373) Microsomal prostaglandin E sy 5e-07
d2cvda1124 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo s 8e-07
d1tu7a277 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulu 3e-06
d1m0ua1127 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (D 4e-06
d1tw9a1129 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoid 9e-06
d1jlva284 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anoph 1e-05
d2gsta1133 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norv 1e-05
d2a2ra277 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapien 4e-05
d1r5aa285 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anoph 5e-05
d1gwca1138 a.45.1.1 (A:87-224) Class tau GST {Aegilops tausch 5e-05
d2gsqa1127 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommast 9e-05
d1e6ba280 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress 1e-04
d1tw9a277 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides 1e-04
d1k3ya279 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sap 1e-04
d1oe8a1123 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke ( 1e-04
d1gsua1133 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus 2e-04
d1fw1a283 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapi 2e-04
d1tu7a1131 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvu 3e-04
d2fhea1136 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepa 3e-04
d1m0ua276 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Dr 3e-04
d1fhea280 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepati 3e-04
d1aw9a281 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), 3e-04
d2c4ja284 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapien 3e-04
d1axda280 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), 5e-04
d1oe8a281 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Sc 5e-04
d1g7oa275 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli 6e-04
d1okta1126 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Pla 0.001
d1duga280 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma jap 0.001
d1oyja284 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativ 0.001
d1v2aa283 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anoph 0.002
d1gula277 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sap 0.002
d1okta285 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasm 0.002
d2gsqa275 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastre 0.003
d2cvda274 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sap 0.003
d2fnoa287 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752 0.003
d1k0ma1149 a.45.1.1 (A:92-240) Chloride intracellular channel 0.004
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 129 Back     information, alignment and structure

class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]
 Score = 93.5 bits (232), Expect = 3e-26
 Identities = 36/102 (35%), Positives = 59/102 (57%), Gaps = 1/102 (0%)

Query: 41  RDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEGQTTILEDKKKIALEALDFVEGLLKQ 100
           +D + RAIVD RLHFD G L+  + +   P ++ G       K K+A EAL + E +LKQ
Sbjct: 1   KDFRSRAIVDQRLHFDLGTLYQRVVDYYFPTIHLGAHLDQTKKAKLA-EALGWFEAMLKQ 59

Query: 101 TEWVAGDKMTVADFSLVATVTSLATLLPEVESYWKIQAWIKR 142
            +W A +  T+AD +L  TV+ +     ++  Y +++AW+ +
Sbjct: 60  YQWSAANHFTIADIALCVTVSQIEAFQFDLHPYPRVRAWLLK 101


>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 125 Back     information, alignment and structure
>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 123 Back     information, alignment and structure
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Length = 127 Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Length = 143 Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 151 Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 129 Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 133 Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 140 Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Length = 121 Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Length = 121 Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 126 Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 142 Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Length = 121 Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 144 Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 132 Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 135 Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Length = 161 Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 77 Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 127 Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 129 Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Length = 84 Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 133 Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Length = 85 Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Length = 138 Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 127 Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Length = 77 Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 123 Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Length = 133 Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Length = 131 Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 136 Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 76 Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Length = 80 Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Length = 81 Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Length = 80 Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Length = 81 Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 126 Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Length = 80 Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Length = 84 Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Length = 83 Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 85 Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Length = 75 Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Length = 87 Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query142
d1jlwa1127 Class delta GST {Mosquito (Anopheles dirus b), iso 99.83
d1jlva1123 Class delta GST {Mosquito (Anopheles dirus b), iso 99.83
d1v2aa1125 Class delta GST {Mosquito (Anopheles dirus b), iso 99.82
d1f2ea1121 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.82
d1r5aa1129 Class delta GST {Mosquito (Anopheles dirus b), iso 99.81
d1n2aa1121 Class beta GST {Escherichia coli [TaxId: 562]} 99.81
d1ljra1165 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.8
d1pmta1121 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.8
d1axda1129 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.79
d1aw9a1135 Class phi GST {Maize (Zea mays), type III [TaxId: 99.79
d1fw1a1125 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.76
d1e6ba1133 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.76
d1nhya1144 GST-like domain of elongation factor 1-gamma {Bake 99.76
d1gwca1138 Class tau GST {Aegilops tauschii, also known as Tr 99.75
d3gtub1140 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.74
d1gnwa1126 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.73
d2cvda1124 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.71
d2c4ja1133 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1eema1139 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.71
d1k0da1151 Yeast prion protein ure2p, nitrogen regulation fra 99.7
d2gsta1133 Class mu GST {Rat (Rattus norvegicus) [TaxId: 1011 99.7
d2a2ra1132 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.7
d1gsua1133 Class mu GST {Chicken (Gallus gallus) [TaxId: 9031 99.69
d2gsqa1127 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.69
d1k3ya1142 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.68
d1m0ua1127 Class sigma GST {Fruit fly (Drosophila melanogaste 99.68
d1b48a1143 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.67
d1gula1140 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.67
d1duga1140 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.66
d2fhea1136 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.65
d1tw9a1129 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.63
d1tu7a1131 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.55
d1okta1126 Pf GST {Malarial parasite (Plasmodium falciparum) 99.54
d1oyja1145 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.52
d1oe8a1123 Class alpha GST {Blood fluke (Schistosoma haematob 99.51
d1r5aa285 Class delta GST {Mosquito (Anopheles dirus b), iso 99.46
d1v2aa283 Class delta GST {Mosquito (Anopheles dirus b), iso 99.44
d1jlva284 Class delta GST {Mosquito (Anopheles dirus b), iso 99.44
d2hrkb1118 GU4 nucleic-binding protein 1, Arc1p {Baker's yeas 99.36
d1gnwa284 Class phi GST {Mouse-ear cress (Arabidopsis thalia 99.32
d1aw9a281 Class phi GST {Maize (Zea mays), type III [TaxId: 99.32
d1fw1a283 Class zeta GST {Human (Homo sapiens) [TaxId: 9606] 99.3
d1axda280 Class phi GST {Maize (Zea mays), type I [TaxId: 45 99.27
d1e6ba280 Class zeta GST {Mouse-ear cress (Arabidopsis thali 99.26
d1f2ea280 Class beta GST {Sphingomonas paucimobilis [TaxId: 99.26
d1tu7a277 Class pi GST {Onchocerca volvulus [TaxId: 6282]} 99.25
d1k3ya279 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.25
d1z9ha1161 Microsomal prostaglandin E synthase-2 {Crab-eating 99.24
d1pmta280 Class beta GST {Proteus mirabilis [TaxId: 584]} 99.23
d1gula277 Class alpha GST {Human (Homo sapiens), (a1-1) [Tax 99.23
d1ljra279 Class theta GST {Human (Homo sapiens) [TaxId: 9606 99.22
d2c4ja284 Class mu GST {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1oyja284 Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} 99.2
d2a2ra277 Class pi GST {Human (Homo sapiens) [TaxId: 9606]} 99.19
d1b48a278 Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax 99.19
d1n2aa280 Class beta GST {Escherichia coli [TaxId: 562]} 99.18
d1tw9a277 Class sigma GST {Heligmosomoides polygyrus [TaxId: 99.16
d2gsqa275 Class sigma GST {Squid (Ommastrephes sloani pacifi 99.16
d1m0ua276 Class sigma GST {Fruit fly (Drosophila melanogaste 99.16
d1duga280 Class alpha GST {Schistosoma japonicum [TaxId: 618 99.15
d1k0ma286 Chloride intracellular channel 1 (clic1) {Human (H 99.15
d2cvda274 Class sigma GST {Human (Homo sapiens) [TaxId: 9606 99.14
d1eema298 Class omega GST {Human (Homo sapiens) [TaxId: 9606 99.14
d1okta285 Pf GST {Malarial parasite (Plasmodium falciparum) 99.14
d1k0da292 Yeast prion protein ure2p, nitrogen regulation fra 99.05
d1fhea280 Class alpha GST {Fasciola hepatica [TaxId: 6192]} 99.02
d1k0ma1149 Chloride intracellular channel 1 (clic1) {Human (H 99.01
d1nhya275 GST-like domain of elongation factor 1-gamma {Bake 98.99
d2fnoa287 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 98.92
d1g7oa275 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 98.91
d1gwca283 Class tau GST {Aegilops tauschii, also known as Tr 98.78
d1oe8a281 Class alpha GST {Blood fluke (Schistosoma haematob 98.59
d1z9ha2113 Microsomal prostaglandin E synthase-2 {Crab-eating 98.46
d2fnoa1149 Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac 97.74
d1g7oa1140 Glutaredoxin 2 {Escherichia coli [TaxId: 562]} 97.4
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]} Back     information, alignment and structure
class: All alpha proteins
fold: GST C-terminal domain-like
superfamily: GST C-terminal domain-like
family: Glutathione S-transferase (GST), C-terminal domain
domain: Class delta GST
species: Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]
Probab=99.83  E-value=1.8e-20  Score=113.02  Aligned_cols=101  Identities=30%  Similarity=0.548  Sum_probs=85.9

Q ss_pred             ccHHHHHHHHHHHhhhccccchhhhHhHhhhhhcC-cccchHHHHHHHHHHHHHHHhhccCCceec-cCCccHHHHHHHH
Q psy7998          41 RDLKKRAIVDSRLHFDNGVLFPSLANIIRPMVYEG-QTTILEDKKKIALEALDFVEGLLKQTEWVA-GDKMTVADFSLVA  118 (142)
Q Consensus        41 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~l~~le~~L~~~~fl~-G~~~s~aD~~~~~  118 (142)
                      +|+.+|+++++|++|..+.+.+.+...+.+.+... .+...++..+.+.+.++.||++|++++|++ |+++|+|||++++
T Consensus         1 sDp~~RA~v~qwL~f~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~le~~L~~~~~la~Gd~~TiADi~~~~   80 (127)
T d1jlwa1           1 SDPRRRAVVHQRLFFDVAVLYQRFAEYYYPQIFGQKVPVGDPGRLRSMEQALEFLNTFLEGEQYVAGGDDPTIADLSILA   80 (127)
T ss_dssp             CSHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHSTTCCSSCCHHHHHHHHHHHHHHHHHTTTCSSTTCSSSCCHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHcCCCchHHHHHHHHHHHHHHHHHHHhccCCceeccCccchhhHHHHH
Confidence            47889999999999998889888877766665543 334456778899999999999999999995 9999999999999


Q ss_pred             HHHHHhhhCC-CccccHHHHHhHhC
Q psy7998         119 TVTSLATLLP-EVESYWKIQAWIKR  142 (142)
Q Consensus       119 ~l~~~~~~~~-~~~~~p~l~~~~~r  142 (142)
                      .+.++ ...+ +.++||+|.+|++|
T Consensus        81 ~~~~~-~~~~~~~~~~P~l~~w~~r  104 (127)
T d1jlwa1          81 TIATY-EVAGYDLRRYENVQRWYER  104 (127)
T ss_dssp             HHHHH-HHTTCCGGGSHHHHHHHHH
T ss_pred             HHHHH-HHcCCChhhChHHHHHHHH
Confidence            99988 5557 88999999999985



>d1jlva1 a.45.1.1 (A:85-207) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa1 a.45.1.1 (A:84-208) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1f2ea1 a.45.1.1 (A:81-201) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1r5aa1 a.45.1.1 (A:87-215) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1n2aa1 a.45.1.1 (A:81-201) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ljra1 a.45.1.1 (A:80-244) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmta1 a.45.1.1 (A:81-201) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1axda1 a.45.1.1 (A:81-210) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1aw9a1 a.45.1.1 (A:83-217) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1fw1a1 a.45.1.1 (A:88-212) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e6ba1 a.45.1.1 (A:88-220) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhya1 a.45.1.1 (A:76-219) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gwca1 a.45.1.1 (A:87-224) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d3gtub1 a.45.1.1 (B:85-224) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gnwa1 a.45.1.1 (A:86-211) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cvda1 a.45.1.1 (A:76-199) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja1 a.45.1.1 (A:86-218) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eema1 a.45.1.1 (A:103-241) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k0da1 a.45.1.1 (A:201-351) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gsta1 a.45.1.1 (A:85-217) Class mu GST {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a2ra1 a.45.1.1 (A:78-209) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gsua1 a.45.1.1 (A:85-217) Class mu GST {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2gsqa1 a.45.1.1 (A:76-202) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1k3ya1 a.45.1.1 (A:81-222) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1m0ua1 a.45.1.1 (A:123-249) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b48a1 a.45.1.1 (A:80-222) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1gula1 a.45.1.1 (A:81-220) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1duga1 a.45.1.1 (A:81-220) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d2fhea1 a.45.1.1 (A:81-216) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1tw9a1 a.45.1.1 (A:78-206) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d1tu7a1 a.45.1.1 (A:78-208) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1okta1 a.45.1.1 (A:86-211) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1oyja1 a.45.1.1 (A:86-230) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1oe8a1 a.45.1.1 (A:85-207) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} Back     information, alignment and structure
>d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} Back     information, alignment and structure
>d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} Back     information, alignment and structure
>d2hrkb1 a.45.1.2 (B:4-121) GU4 nucleic-binding protein 1, Arc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} Back     information, alignment and structure
>d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} Back     information, alignment and structure
>d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} Back     information, alignment and structure
>d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} Back     information, alignment and structure
>d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1z9ha1 a.45.1.1 (A:213-373) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} Back     information, alignment and structure
>d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} Back     information, alignment and structure
>d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} Back     information, alignment and structure
>d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} Back     information, alignment and structure
>d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} Back     information, alignment and structure
>d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} Back     information, alignment and structure
>d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} Back     information, alignment and structure
>d1k0ma1 a.45.1.1 (A:92-240) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} Back     information, alignment and structure
>d1oe8a2 c.47.1.5 (A:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]} Back     information, alignment and structure
>d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} Back     information, alignment and structure
>d2fnoa1 a.45.1.1 (A:88-236) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1g7oa1 a.45.1.1 (A:76-215) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure