Diaphorina citri psyllid: psy8002


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------47
MVTKDCTGVGGACKARVNNIVKSEFDKREYRGLELQNGMKKWTNPSPNEFIATDFSLLPSDPDISPHPTILYNSPLIRAWHKQDDEYRVPKLNASFEFISPYAYLDPECTNMTHLFISLFKDALNEYSYDAKLAGLAWDLSNTKYGMMLGISGYSHKQSVLLSKVLDKLADFSNHIDPKRYEIIKEQYYRGLKNFEAEQPYQHAIYSISLCLFERAWSKTELLESLDGITREKLVEFSHDLLSKMFIEALIHGNANKQVGLSIVKMLEEKLQTKLKAKPLLPSQLLRFREIKIPEKSNLVYETQNAVHKSSCIEAYYQCGVQELRDNVLLELFYPIPDEHTHYQEQLGYIVVSGIRKSSGVQGLRIIVQSDKHPLFVDSRIEAFLAQMKDLISNMPDEEFQSHKEALSAQRLEKPKKLSGLSSRFWLEITTQQYNFDRANIEVAYLKSVTKENVLKFYDKRNYTESLND
cccccccccccccccEEccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccEEEEccccEEEEEEcccccccccccEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccEEcccEEEEEEcccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccHHHHHHHcccccHHHHHHHHHHHHcccEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccccEEccccccccccEEEEEEEcccccHHHHHHHHHHcccccccHHHHHcccEEEEEEEECcccCEEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHHHHHcccccccc
****DCTGVGGACKARVNNIVKSEFDKREYRGLELQNGMKKWTNPSPNEFIATDFSLLPSDPDISPHPTILYNSPLIRAWHKQDDEYRVPKLNASFEFISPYAYLDPECTNMTHLFISLFKDALNEYSYDAKLAGLAWDLSNTKYGMMLGISGYSHKQSVLLSKVLDKLADFSNHIDPKRYEIIKEQYYRGLKNFEAEQPYQHAIYSISLCLFERAWSKTELLESLDGITREKLVEFSHDLLSKMFIEALIHGNANKQVGLSIVKMLEEKLQTKLKAKPLLPSQLLRFREIKIPEKSNLVYETQNAVHKSSCIEAYYQCGVQELRDNVLLELFYPIPDEHTHYQEQLGYIVVSGIRKSSGVQGLRIIVQSDKHPLFVDSRIEAFLAQMKDLISNMPDEEFQSHKEALSAQRLEKPKKLSGLSSRFWLEITTQQYNFDRANIEVAYLKSVTKENVLKFYDKR*YT*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTKDCTGVGGACKARVNNIVKSEFDKREYRGLELQNGMKKWTNPSPNEFIATDFSLLPSDPDISPHPTILYNSPLIRAWHKQDDEYRVPKLNASFEFISPYAYLDPECTNMTHLFISLFKDALNEYSYDAKLAGLAWDLSNTKYGMMLGISGYSHKQSVLLSKVLDKLADFSNHIDPKRYEIIKEQYYRGLKNFEAEQPYQHAIYSISLCLFERAWSKTELLESLDGITREKLVEFSHDLLSKMFIEALIHGNANKQVGLSIVKMLEEKLQTKLKAKPLLPSQLLRFREIKIPEKSNLVYETQNAVHKSSCIEAYYQCGVQELRDNVLLELFYPIPDEHTHYQEQLGYIVVSGIRKSSGVQGLRIIVQSDKHPLFVDSRIEAFLAQMKDLISNMPDEEFQSHKEALSAQRLEKPKKLSGLSSRFWLEITTQQYNFDRANIEVAYLKSVTKENVLKFYDKRNYTESLND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0003824 [MF]catalytic activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CWW, chain A
Confidence level:very confident
Coverage over the Query: 18-465
View the alignment between query and template
View the model in PyMOL