Diaphorina citri psyllid: psy800


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTDCHDSHLLSYFASDLINFIWGLPMITPITCAYSRSHQYRTLTHLLYTMTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTPEGRRITKLDQILLNGNNITMLGLHTHCGMRPYIQHSMGE
cccccccccccccccHHHHHHHcccEEEEEEcccEEEEEEEEccccEEEEEEEcCEEEcccccEEEEccEEEcccccEEEEEccccccccccccccccccccccccccccccccccccHHHHHHHcccEEEEEEcccEEEEEEEccccccccEEcccCEEEEEccccCEEEEEccEEECcccEEEEccccccccccHHHccccc
***********TLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTDCHDSHLLSYFASDLINFIWGLPMITPITCAYSRSHQYRTLTHLLYTMTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTP**RRITKLDQILLNGNNITMLGLHTHCGMRPYIQ*S***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTDCHDSHLLSYFASDLINFIWGLPMITPITCAYSRSHQYRTLTHLLYTMTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTPEGRRITKLDQILLNGNNITMLGLHTHCGMRPYIQHSMGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
U6 snRNA-associated Sm-like protein LSm5 Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.confidentQ2HJH0
U6 snRNA-associated Sm-like protein LSm5 Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.confidentQ5R628
U6 snRNA-associated Sm-like protein LSm5 Plays a role in U6 snRNP assembly and function. Binds to the 3' end of U6 snRNA, thereby facilitating U4/U6 duplex formation in vitro.confidentQ9Y4Y9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0040020 [BP]regulation of meiosisprobableGO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0000003 [BP]reproductionprobableGO:0008150
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009737 [BP]response to abscisic acid stimulusprobableGO:1901700, GO:0009719, GO:0033993, GO:0050896, GO:0008150, GO:0009725, GO:0042221, GO:0097305, GO:0010033
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009414 [BP]response to water deprivationprobableGO:1901700, GO:0009628, GO:0050896, GO:0006950, GO:0008150, GO:0009415, GO:0042221, GO:0010035
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0008380 [BP]RNA splicingprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0043928 [BP]exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0000288, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0000291, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0030532 [CC]small nuclear ribonucleoprotein complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0006397 [BP]mRNA processingprobableGO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2FWK, chain A
Confidence level:very confident
Coverage over the Query: 113-189
View the alignment between query and template
View the model in PyMOL
Template: 2FWK, chain A
Confidence level:very confident
Coverage over the Query: 10-74
View the alignment between query and template
View the model in PyMOL