Psyllid ID: psy800
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 204 | ||||||
| 242023983 | 91 | conserved hypothetical protein [Pediculu | 0.401 | 0.901 | 0.975 | 3e-36 | |
| 193582383 | 91 | PREDICTED: u6 snRNA-associated Sm-like p | 0.397 | 0.890 | 0.950 | 3e-36 | |
| 156555736 | 93 | PREDICTED: U6 snRNA-associated Sm-like p | 0.401 | 0.881 | 0.902 | 7e-35 | |
| 307178103 | 91 | U6 snRNA-associated Sm-like protein LSm5 | 0.397 | 0.890 | 0.913 | 9e-35 | |
| 322791094 | 83 | hypothetical protein SINV_04240 [Solenop | 0.397 | 0.975 | 0.901 | 9e-35 | |
| 332026604 | 91 | U6 snRNA-associated Sm-like protein LSm5 | 0.401 | 0.901 | 0.915 | 1e-34 | |
| 307197393 | 91 | U6 snRNA-associated Sm-like protein LSm5 | 0.387 | 0.868 | 0.924 | 2e-34 | |
| 170055785 | 92 | Lsm5 protein [Culex quinquefasciatus] gi | 0.397 | 0.880 | 0.913 | 8e-34 | |
| 110760718 | 91 | PREDICTED: u6 snRNA-associated Sm-like p | 0.387 | 0.868 | 0.924 | 8e-34 | |
| 290561451 | 95 | U6 snRNA-associated Sm-like protein LSm5 | 0.406 | 0.873 | 0.867 | 1e-33 |
| >gi|242023983|ref|XP_002432410.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517833|gb|EEB19672.1| conserved hypothetical protein [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 157 bits (397), Expect = 3e-36, Method: Compositional matrix adjust.
Identities = 81/83 (97%), Positives = 81/83 (97%), Gaps = 1/83 (1%)
Query: 104 MTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYES 163
MTA SVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTL GFDDFVNMLLEDVTEYES
Sbjct: 1 MTA-SVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLLGFDDFVNMLLEDVTEYES 59
Query: 164 TPEGRRITKLDQILLNGNNITML 186
TPEGRRITKLDQILLNGNNITML
Sbjct: 60 TPEGRRITKLDQILLNGNNITML 82
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|193582383|ref|XP_001951255.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm5-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|156555736|ref|XP_001602011.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm5-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|307178103|gb|EFN66930.1| U6 snRNA-associated Sm-like protein LSm5 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|322791094|gb|EFZ15676.1| hypothetical protein SINV_04240 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|332026604|gb|EGI66713.1| U6 snRNA-associated Sm-like protein LSm5 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307197393|gb|EFN78665.1| U6 snRNA-associated Sm-like protein LSm5 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|170055785|ref|XP_001863736.1| Lsm5 protein [Culex quinquefasciatus] gi|167875611|gb|EDS38994.1| Lsm5 protein [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|110760718|ref|XP_001120607.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm5-like [Apis mellifera] gi|340715932|ref|XP_003396461.1| PREDICTED: u6 snRNA-associated Sm-like protein LSm5-like [Bombus terrestris] gi|350396810|ref|XP_003484674.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm5-like [Bombus impatiens] gi|380019757|ref|XP_003693769.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm5-like [Apis florea] gi|383866113|ref|XP_003708516.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm5-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|290561451|gb|ADD38126.1| U6 snRNA-associated Sm-like protein LSm5 [Lepeophtheirus salmonis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 204 | ||||||
| ZFIN|ZDB-GENE-070822-23 | 91 | zgc:171959 "zgc:171959" [Danio | 0.397 | 0.890 | 0.888 | 1.5e-33 | |
| FB|FBgn0035675 | 91 | CG6610 [Drosophila melanogaste | 0.406 | 0.912 | 0.855 | 5.2e-33 | |
| UNIPROTKB|Q2HJH0 | 91 | LSM5 "U6 snRNA-associated Sm-l | 0.397 | 0.890 | 0.864 | 6.7e-33 | |
| UNIPROTKB|Q9Y4Y9 | 91 | LSM5 "U6 snRNA-associated Sm-l | 0.397 | 0.890 | 0.864 | 6.7e-33 | |
| MGI|MGI:1913623 | 91 | Lsm5 "LSM5 homolog, U6 small n | 0.397 | 0.890 | 0.864 | 6.7e-33 | |
| WB|WBGene00003079 | 91 | lsm-5 [Caenorhabditis elegans | 0.397 | 0.890 | 0.765 | 6.2e-30 | |
| UNIPROTKB|O18694 | 91 | lsm-5 "Protein LSM-5" [Caenorh | 0.397 | 0.890 | 0.765 | 6.2e-30 | |
| TAIR|locus:2156589 | 88 | SAD1 "SUPERSENSITIVE TO ABA AN | 0.382 | 0.886 | 0.730 | 1.2e-26 | |
| DICTYBASE|DDB_G0268716 | 97 | lsm5 "putative U6 small nuclea | 0.357 | 0.752 | 0.698 | 1e-22 | |
| ASPGD|ASPL0000026389 | 129 | AN5679 [Emericella nidulans (t | 0.406 | 0.643 | 0.616 | 9e-22 |
| ZFIN|ZDB-GENE-070822-23 zgc:171959 "zgc:171959" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 365 (133.5 bits), Expect = 1.5e-33, P = 1.5e-33
Identities = 72/81 (88%), Positives = 75/81 (92%)
Query: 106 APSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTP 165
A ATNPS LLPLELVDKCIGSRIHI+MKNDKEIVGTL GFDDFVNM+LEDVTE+E TP
Sbjct: 2 AAITATNPSQLLPLELVDKCIGSRIHIVMKNDKEIVGTLLGFDDFVNMVLEDVTEFEITP 61
Query: 166 EGRRITKLDQILLNGNNITML 186
EGRRITKLDQILLNGNNITML
Sbjct: 62 EGRRITKLDQILLNGNNITML 82
|
|
| FB|FBgn0035675 CG6610 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2HJH0 LSM5 "U6 snRNA-associated Sm-like protein LSm5" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y4Y9 LSM5 "U6 snRNA-associated Sm-like protein LSm5" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913623 Lsm5 "LSM5 homolog, U6 small nuclear RNA associated (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00003079 lsm-5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O18694 lsm-5 "Protein LSM-5" [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2156589 SAD1 "SUPERSENSITIVE TO ABA AND DROUGHT 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0268716 lsm5 "putative U6 small nuclear ribonucleoparticle-associated protein" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000026389 AN5679 [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 204 | |||
| cd01732 | 76 | cd01732, LSm5, Like-Sm protein 5 | 2e-47 | |
| cd01732 | 76 | cd01732, LSm5, Like-Sm protein 5 | 2e-26 | |
| smart00651 | 67 | smart00651, Sm, snRNP Sm proteins | 2e-17 | |
| pfam01423 | 66 | pfam01423, LSM, LSM domain | 1e-16 | |
| COG1958 | 79 | COG1958, LSM1, Small nuclear ribonucleoprotein (sn | 2e-14 | |
| cd00600 | 63 | cd00600, Sm_like, Sm and related proteins | 7e-14 | |
| pfam01423 | 66 | pfam01423, LSM, LSM domain | 2e-09 | |
| smart00651 | 67 | smart00651, Sm, snRNP Sm proteins | 3e-09 | |
| COG1958 | 79 | COG1958, LSM1, Small nuclear ribonucleoprotein (sn | 4e-09 | |
| cd01731 | 69 | cd01731, archaeal_Sm1, archaeal Sm protein 1 | 5e-09 | |
| cd00600 | 63 | cd00600, Sm_like, Sm and related proteins | 1e-08 | |
| cd11678 | 69 | cd11678, archaeal_LSm, archaeal Like-Sm protein | 2e-08 | |
| cd01718 | 79 | cd01718, Sm_E, Sm protein E | 2e-08 | |
| cd01730 | 82 | cd01730, LSm3, Like-Sm protein 3 | 3e-08 | |
| PTZ00138 | 89 | PTZ00138, PTZ00138, small nuclear ribonucleoprotei | 1e-06 | |
| cd01726 | 68 | cd01726, LSm6, Like-Sm protein 6 | 1e-06 | |
| cd01730 | 82 | cd01730, LSm3, Like-Sm protein 3 | 3e-06 | |
| PRK00737 | 72 | PRK00737, PRK00737, small nuclear ribonucleoprotei | 5e-06 | |
| cd01731 | 69 | cd01731, archaeal_Sm1, archaeal Sm protein 1 | 3e-05 | |
| cd01727 | 91 | cd01727, LSm8, Like-Sm protein 8 | 4e-05 | |
| cd11678 | 69 | cd11678, archaeal_LSm, archaeal Like-Sm protein | 1e-04 | |
| cd01719 | 70 | cd01719, Sm_G, Sm protein G | 2e-04 | |
| cd01728 | 74 | cd01728, LSm1, Like-Sm protein 1 | 3e-04 | |
| cd01722 | 69 | cd01722, Sm_F, Sm protein F | 4e-04 | |
| cd01729 | 89 | cd01729, LSm7, Like-Sm protein 7 | 8e-04 | |
| cd01733 | 78 | cd01733, LSm10, Like-Sm protein 10 | 0.001 | |
| cd06168 | 73 | cd06168, LSMD1, LSM domain containing 1 | 0.002 |
| >gnl|CDD|212479 cd01732, LSm5, Like-Sm protein 5 | Back alignment and domain information |
|---|
Score = 150 bits (380), Expect = 2e-47
Identities = 59/72 (81%), Positives = 66/72 (91%)
Query: 115 TLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTPEGRRITKLD 174
+LPLEL+DKCIGS+I IIMK+DKE VGTL GFDD+VNM+LEDVTEYE TPEGR+ITKLD
Sbjct: 1 QILPLELIDKCIGSKIWIIMKSDKEFVGTLLGFDDYVNMVLEDVTEYEITPEGRKITKLD 60
Query: 175 QILLNGNNITML 186
QILLNGNNI ML
Sbjct: 61 QILLNGNNIAML 72
|
The eukaryotic LSm proteins (LSm2-8 or LSm1-7) assemble into a hetero-heptameric ring around the 3'-terminus uridylation tag of the gamma-methyl triphosphate (gamma-m-P3) capped U6 snRNA. LSm2-8 form the core of the snRNP particle that, in turn, assembles with other components onto the pre-mRNA to form the spliceosome which is responsible for the excision of introns and the ligation of exons. LSm1-7 is involved in recognition of the 3' uridylation tag and recruitment of the decapping machinery. Members of this family share a highly conserved Sm fold containing an N-terminal helix followed by a strongly bent five-stranded antiparallel beta-sheet. Length = 76 |
| >gnl|CDD|212479 cd01732, LSm5, Like-Sm protein 5 | Back alignment and domain information |
|---|
| >gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201787 pfam01423, LSM, LSM domain | Back alignment and domain information |
|---|
| >gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|201787 pfam01423, LSM, LSM domain | Back alignment and domain information |
|---|
| >gnl|CDD|197820 smart00651, Sm, snRNP Sm proteins | Back alignment and domain information |
|---|
| >gnl|CDD|224869 COG1958, LSM1, Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212462 cd00600, Sm_like, Sm and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein | Back alignment and domain information |
|---|
| >gnl|CDD|212465 cd01718, Sm_E, Sm protein E | Back alignment and domain information |
|---|
| >gnl|CDD|212477 cd01730, LSm3, Like-Sm protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|185472 PTZ00138, PTZ00138, small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212473 cd01726, LSm6, Like-Sm protein 6 | Back alignment and domain information |
|---|
| >gnl|CDD|212477 cd01730, LSm3, Like-Sm protein 3 | Back alignment and domain information |
|---|
| >gnl|CDD|179104 PRK00737, PRK00737, small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|212478 cd01731, archaeal_Sm1, archaeal Sm protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212474 cd01727, LSm8, Like-Sm protein 8 | Back alignment and domain information |
|---|
| >gnl|CDD|212489 cd11678, archaeal_LSm, archaeal Like-Sm protein | Back alignment and domain information |
|---|
| >gnl|CDD|212466 cd01719, Sm_G, Sm protein G | Back alignment and domain information |
|---|
| >gnl|CDD|212475 cd01728, LSm1, Like-Sm protein 1 | Back alignment and domain information |
|---|
| >gnl|CDD|212469 cd01722, Sm_F, Sm protein F | Back alignment and domain information |
|---|
| >gnl|CDD|212476 cd01729, LSm7, Like-Sm protein 7 | Back alignment and domain information |
|---|
| >gnl|CDD|212480 cd01733, LSm10, Like-Sm protein 10 | Back alignment and domain information |
|---|
| >gnl|CDD|212486 cd06168, LSMD1, LSM domain containing 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 204 | |||
| KOG1774|consensus | 88 | 99.93 | ||
| cd01732 | 76 | LSm5 The eukaryotic Sm and Sm-like (LSm) proteins | 99.89 | |
| PRK00737 | 72 | small nuclear ribonucleoprotein; Provisional | 99.87 | |
| cd01731 | 68 | archaeal_Sm1 The archaeal sm1 proteins: The Sm pro | 99.86 | |
| PTZ00138 | 89 | small nuclear ribonucleoprotein; Provisional | 99.86 | |
| cd01730 | 82 | LSm3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01726 | 67 | LSm6 The eukaryotic Sm and Sm-like (LSm) proteins | 99.85 | |
| cd01720 | 87 | Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.84 | |
| cd01718 | 79 | Sm_E The eukaryotic Sm and Sm-like (LSm) proteins | 99.84 | |
| cd01722 | 68 | Sm_F The eukaryotic Sm and Sm-like (LSm) proteins | 99.82 | |
| cd01729 | 81 | LSm7 The eukaryotic Sm and Sm-like (LSm) proteins | 99.82 | |
| cd01719 | 72 | Sm_G The eukaryotic Sm and Sm-like (LSm) proteins | 99.82 | |
| cd01728 | 74 | LSm1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.81 | |
| cd01727 | 74 | LSm8 The eukaryotic Sm and Sm-like (LSm) proteins | 99.79 | |
| COG1958 | 79 | LSM1 Small nuclear ribonucleoprotein (snRNP) homol | 99.79 | |
| cd01723 | 76 | LSm4 The eukaryotic Sm and Sm-like (LSm) proteins | 99.79 | |
| cd01721 | 70 | Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.78 | |
| cd01717 | 79 | Sm_B The eukaryotic Sm and Sm-like (LSm) proteins | 99.77 | |
| smart00651 | 67 | Sm snRNP Sm proteins. small nuclear ribonucleoprot | 99.76 | |
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 99.76 | |
| cd01732 | 76 | LSm5 The eukaryotic Sm and Sm-like (LSm) proteins | 99.75 | |
| KOG3482|consensus | 79 | 99.73 | ||
| PRK00737 | 72 | small nuclear ribonucleoprotein; Provisional | 99.73 | |
| cd01731 | 68 | archaeal_Sm1 The archaeal sm1 proteins: The Sm pro | 99.72 | |
| cd01724 | 90 | Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.71 | |
| cd01726 | 67 | LSm6 The eukaryotic Sm and Sm-like (LSm) proteins | 99.71 | |
| KOG1775|consensus | 84 | 99.7 | ||
| cd06168 | 75 | LSm9 The eukaryotic Sm and Sm-like (LSm) proteins | 99.7 | |
| cd01730 | 82 | LSm3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.7 | |
| cd00600 | 63 | Sm_like The eukaryotic Sm and Sm-like (LSm) protei | 99.69 | |
| cd01725 | 81 | LSm2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.69 | |
| cd01719 | 72 | Sm_G The eukaryotic Sm and Sm-like (LSm) proteins | 99.69 | |
| cd01733 | 78 | LSm10 The eukaryotic Sm and Sm-like (LSm) proteins | 99.69 | |
| cd01722 | 68 | Sm_F The eukaryotic Sm and Sm-like (LSm) proteins | 99.68 | |
| cd01718 | 79 | Sm_E The eukaryotic Sm and Sm-like (LSm) proteins | 99.66 | |
| cd01720 | 87 | Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.65 | |
| KOG1780|consensus | 77 | 99.64 | ||
| cd01729 | 81 | LSm7 The eukaryotic Sm and Sm-like (LSm) proteins | 99.63 | |
| COG1958 | 79 | LSM1 Small nuclear ribonucleoprotein (snRNP) homol | 99.63 | |
| KOG3460|consensus | 91 | 99.62 | ||
| KOG1780|consensus | 77 | 99.58 | ||
| cd01721 | 70 | Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins | 99.57 | |
| cd01728 | 74 | LSm1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.55 | |
| cd01723 | 76 | LSm4 The eukaryotic Sm and Sm-like (LSm) proteins | 99.55 | |
| cd01727 | 74 | LSm8 The eukaryotic Sm and Sm-like (LSm) proteins | 99.55 | |
| cd01717 | 79 | Sm_B The eukaryotic Sm and Sm-like (LSm) proteins | 99.53 | |
| KOG3482|consensus | 79 | 99.53 | ||
| KOG1781|consensus | 108 | 99.53 | ||
| PF01423 | 67 | LSM: LSM domain ; InterPro: IPR001163 This family | 99.53 | |
| KOG1775|consensus | 84 | 99.52 | ||
| PTZ00138 | 89 | small nuclear ribonucleoprotein; Provisional | 99.51 | |
| smart00651 | 67 | Sm snRNP Sm proteins. small nuclear ribonucleoprot | 99.5 | |
| cd01724 | 90 | Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins | 99.46 | |
| cd06168 | 75 | LSm9 The eukaryotic Sm and Sm-like (LSm) proteins | 99.46 | |
| KOG1783|consensus | 77 | 99.46 | ||
| cd01733 | 78 | LSm10 The eukaryotic Sm and Sm-like (LSm) proteins | 99.44 | |
| cd00600 | 63 | Sm_like The eukaryotic Sm and Sm-like (LSm) protei | 99.43 | |
| KOG1784|consensus | 96 | 99.4 | ||
| KOG1783|consensus | 77 | 99.38 | ||
| cd01725 | 81 | LSm2 The eukaryotic Sm and Sm-like (LSm) proteins | 99.35 | |
| KOG1782|consensus | 129 | 99.34 | ||
| KOG1774|consensus | 88 | 99.29 | ||
| KOG3460|consensus | 91 | 99.27 | ||
| KOG3293|consensus | 134 | 99.23 | ||
| KOG3448|consensus | 96 | 99.13 | ||
| KOG3168|consensus | 177 | 99.12 | ||
| KOG1781|consensus | 108 | 99.09 | ||
| KOG3172|consensus | 119 | 98.98 | ||
| KOG3459|consensus | 114 | 98.97 | ||
| KOG3428|consensus | 109 | 98.7 | ||
| KOG1784|consensus | 96 | 98.55 | ||
| KOG3293|consensus | 134 | 98.47 | ||
| KOG3168|consensus | 177 | 98.31 | ||
| KOG1782|consensus | 129 | 98.24 | ||
| KOG3448|consensus | 96 | 98.21 | ||
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 97.99 | |
| cd01739 | 66 | LSm11_C The eukaryotic Sm and Sm-like (LSm) protei | 97.94 | |
| KOG3459|consensus | 114 | 97.67 | ||
| cd01739 | 66 | LSm11_C The eukaryotic Sm and Sm-like (LSm) protei | 97.55 | |
| KOG3172|consensus | 119 | 97.45 | ||
| PF14438 | 77 | SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. | 97.16 | |
| KOG3428|consensus | 109 | 96.74 | ||
| cd01716 | 61 | Hfq Hfq, an abundant, ubiquitous RNA-binding prote | 96.01 | |
| PF14438 | 77 | SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1. | 95.85 | |
| TIGR02383 | 61 | Hfq RNA chaperone Hfq. This model represents the R | 95.72 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 95.37 | |
| cd01716 | 61 | Hfq Hfq, an abundant, ubiquitous RNA-binding prote | 95.34 | |
| TIGR02383 | 61 | Hfq RNA chaperone Hfq. This model represents the R | 95.31 | |
| PF12701 | 96 | LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC | 95.16 | |
| PRK00395 | 79 | hfq RNA-binding protein Hfq; Provisional | 95.15 | |
| PRK00395 | 79 | hfq RNA-binding protein Hfq; Provisional | 94.59 | |
| COG1923 | 77 | Hfq Uncharacterized host factor I protein [General | 94.41 | |
| cd01736 | 74 | LSm14_N LSm14 (also known as RAP55) belongs to a f | 93.99 | |
| COG1923 | 77 | Hfq Uncharacterized host factor I protein [General | 93.65 | |
| PF11095 | 80 | Gemin7: Gem-associated protein 7 (Gemin7); InterPr | 91.46 | |
| PRK14091 | 165 | RNA-binding protein Hfq; Provisional | 90.61 | |
| PF03614 | 165 | Flag1_repress: Repressor of phase-1 flagellin; Int | 90.57 | |
| cd01735 | 61 | LSm12_N LSm12 belongs to a family of Sm-like prote | 90.38 | |
| PF02237 | 48 | BPL_C: Biotin protein ligase C terminal domain; In | 87.82 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 87.79 | |
| PRK02001 | 152 | hypothetical protein; Validated | 85.92 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 85.61 | |
| PF10842 | 66 | DUF2642: Protein of unknown function (DUF2642); In | 85.54 | |
| PF06372 | 166 | Gemin6: Gemin6 protein; InterPro: IPR009422 This f | 84.06 | |
| PRK14639 | 140 | hypothetical protein; Provisional | 83.79 | |
| PF12701 | 96 | LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC | 83.65 | |
| cd01735 | 61 | LSm12_N LSm12 belongs to a family of Sm-like prote | 83.43 | |
| PF06372 | 166 | Gemin6: Gemin6 protein; InterPro: IPR009422 This f | 82.48 | |
| PRK14638 | 150 | hypothetical protein; Provisional | 82.1 | |
| PRK14644 | 136 | hypothetical protein; Provisional | 80.29 |
| >KOG1774|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.2e-26 Score=167.96 Aligned_cols=79 Identities=28% Similarity=0.500 Sum_probs=70.7
Q ss_pred cceeeccccccceeecccEeEEEeeeccCCcccCCCCCCCcHHHHHhhcCCEEEEEEeCCeEEEEEEEEEcCccceEEcc
Q psy800 78 LPMITPITCAYSRSHQYRTLTHLLYTMTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLED 157 (204)
Q Consensus 78 ~~~~~PI~~~f~~~~~~~~v~~~l~~~~~~~~~~~~~~~~Pl~~L~~~i~k~V~V~Lk~gr~i~G~L~gfD~~mNlVL~d 157 (204)
-+|++|||+||+|||++.+|++||||+ -+.+++|.+.|||+|||+||||
T Consensus 8 kvmv~Pin~Ifr~Lq~~t~VqIWl~eq-------------------------------~~~rieG~IvGFDEyMNvVlD~ 56 (88)
T KOG1774|consen 8 KVMVQPINLIFRFLQNRTRVQIWLFEQ-------------------------------VGLRIEGRIVGFDEYMNLVLDD 56 (88)
T ss_pred ceecCcHHHHHHHHhcCCceEEEEEec-------------------------------cCcEEeEEEechHHhhhhhhcc
Confidence 378999999999999999999999997 4669999999999999999999
Q ss_pred eEEEeecCCCeeeeeeCeEEEeCCcEEEEccc
Q psy800 158 VTEYESTPEGRRITKLDQILLNGNNITMLGLH 189 (204)
Q Consensus 158 a~E~~~~~~~~~~~~lg~ilIRGdnI~~I~~~ 189 (204)
|+|...+. +..+.+|+++++||||.+|...
T Consensus 57 aeev~~k~--~~rk~lGRilLKGDnItli~~~ 86 (88)
T KOG1774|consen 57 AEEVHSKT--KSRKELGRILLKGDNITLIQSA 86 (88)
T ss_pred hhhccccc--cCCCccccEEEcCCcEEEEeec
Confidence 99998653 2356999999999999999654
|
|
| >cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PRK00737 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences | Back alignment and domain information |
|---|
| >PTZ00138 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >smart00651 Sm snRNP Sm proteins | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >cd01732 LSm5 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3482|consensus | Back alignment and domain information |
|---|
| >PRK00737 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >cd01731 archaeal_Sm1 The archaeal sm1 proteins: The Sm proteins are conserved in all three domains of life and are always associated with U-rich RNA sequences | Back alignment and domain information |
|---|
| >cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01726 LSm6 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1775|consensus | Back alignment and domain information |
|---|
| >cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01730 LSm3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01719 Sm_G The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01722 Sm_F The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01718 Sm_E The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01720 Sm_D2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1780|consensus | Back alignment and domain information |
|---|
| >cd01729 LSm7 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >COG1958 LSM1 Small nuclear ribonucleoprotein (snRNP) homolog [Transcription] | Back alignment and domain information |
|---|
| >KOG3460|consensus | Back alignment and domain information |
|---|
| >KOG1780|consensus | Back alignment and domain information |
|---|
| >cd01721 Sm_D3 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01728 LSm1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01723 LSm4 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01727 LSm8 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd01717 Sm_B The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3482|consensus | Back alignment and domain information |
|---|
| >KOG1781|consensus | Back alignment and domain information |
|---|
| >PF01423 LSM: LSM domain ; InterPro: IPR001163 This family is found in Lsm (like-Sm) proteins and in bacterial Lsm-related Hfq proteins | Back alignment and domain information |
|---|
| >KOG1775|consensus | Back alignment and domain information |
|---|
| >PTZ00138 small nuclear ribonucleoprotein; Provisional | Back alignment and domain information |
|---|
| >smart00651 Sm snRNP Sm proteins | Back alignment and domain information |
|---|
| >cd01724 Sm_D1 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd06168 LSm9 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1783|consensus | Back alignment and domain information |
|---|
| >cd01733 LSm10 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >cd00600 Sm_like The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1784|consensus | Back alignment and domain information |
|---|
| >KOG1783|consensus | Back alignment and domain information |
|---|
| >cd01725 LSm2 The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG1782|consensus | Back alignment and domain information |
|---|
| >KOG1774|consensus | Back alignment and domain information |
|---|
| >KOG3460|consensus | Back alignment and domain information |
|---|
| >KOG3293|consensus | Back alignment and domain information |
|---|
| >KOG3448|consensus | Back alignment and domain information |
|---|
| >KOG3168|consensus | Back alignment and domain information |
|---|
| >KOG1781|consensus | Back alignment and domain information |
|---|
| >KOG3172|consensus | Back alignment and domain information |
|---|
| >KOG3459|consensus | Back alignment and domain information |
|---|
| >KOG3428|consensus | Back alignment and domain information |
|---|
| >KOG1784|consensus | Back alignment and domain information |
|---|
| >KOG3293|consensus | Back alignment and domain information |
|---|
| >KOG3168|consensus | Back alignment and domain information |
|---|
| >KOG1782|consensus | Back alignment and domain information |
|---|
| >KOG3448|consensus | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3459|consensus | Back alignment and domain information |
|---|
| >cd01739 LSm11_C The eukaryotic Sm and Sm-like (LSm) proteins associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >KOG3172|consensus | Back alignment and domain information |
|---|
| >PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 | Back alignment and domain information |
|---|
| >KOG3428|consensus | Back alignment and domain information |
|---|
| >cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others | Back alignment and domain information |
|---|
| >PF14438 SM-ATX: Ataxin 2 SM domain; PDB: 1M5Q_1 | Back alignment and domain information |
|---|
| >TIGR02383 Hfq RNA chaperone Hfq | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >cd01716 Hfq Hfq, an abundant, ubiquitous RNA-binding protein, functions as a pleiotrophic regulator of RNA metabolism in prokaryotes, required for transcription of some transcripts and degradation of others | Back alignment and domain information |
|---|
| >TIGR02383 Hfq RNA chaperone Hfq | Back alignment and domain information |
|---|
| >PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A | Back alignment and domain information |
|---|
| >PRK00395 hfq RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PRK00395 hfq RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd01736 LSm14_N LSm14 (also known as RAP55) belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >COG1923 Hfq Uncharacterized host factor I protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF11095 Gemin7: Gem-associated protein 7 (Gemin7); InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins | Back alignment and domain information |
|---|
| >PRK14091 RNA-binding protein Hfq; Provisional | Back alignment and domain information |
|---|
| >PF03614 Flag1_repress: Repressor of phase-1 flagellin; InterPro: IPR003223 Flagellin is the subunit which polymerises to form the filaments of bacterial flagella | Back alignment and domain information |
|---|
| >cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF02237 BPL_C: Biotin protein ligase C terminal domain; InterPro: IPR003142 This C-terminal domain has an SH3-like barrel fold, the function of which is unknown | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK02001 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF10842 DUF2642: Protein of unknown function (DUF2642); InterPro: IPR020139 This entry contains proteins with no known function | Back alignment and domain information |
|---|
| >PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins | Back alignment and domain information |
|---|
| >PRK14639 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF12701 LSM14: Scd6-like Sm domain; PDB: 2RM4_A 2FB7_A 2VC8_A 2VXF_A 2VXE_A | Back alignment and domain information |
|---|
| >cd01735 LSm12_N LSm12 belongs to a family of Sm-like proteins that associate with RNA to form the core domain of the ribonucleoprotein particles involved in a variety of RNA processing events including pre-mRNA splicing, telomere replication, and mRNA degradation | Back alignment and domain information |
|---|
| >PF06372 Gemin6: Gemin6 protein; InterPro: IPR009422 This family consists of several mammalian Gemin6 proteins | Back alignment and domain information |
|---|
| >PRK14638 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14644 hypothetical protein; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 204 | ||||
| 2fwk_A | 121 | Crystal Structure Of Cryptosporidium Parvum U6 Snrn | 2e-16 | ||
| 3swn_A | 82 | Structure Of The Lsm657 Complex: An Assembly Interm | 7e-16 | ||
| 4emk_A | 94 | Crystal Structure Of Splsm567 Length = 94 | 6e-14 | ||
| 1ljo_A | 77 | Crystal Structure Of An Sm-Like Protein (Af-Sm2) Fr | 7e-05 | ||
| 3cw1_E | 92 | Crystal Structure Of Human Spliceosomal U1 Snrnp Le | 6e-04 |
| >pdb|2FWK|A Chain A, Crystal Structure Of Cryptosporidium Parvum U6 Snrna- Associated Sm-Like Protein Lsm5 Length = 121 | Back alignment and structure |
|
| >pdb|3SWN|A Chain A, Structure Of The Lsm657 Complex: An Assembly Intermediate Of The Lsm1 7 And Lsm2 8 Rings Length = 82 | Back alignment and structure |
| >pdb|4EMK|A Chain A, Crystal Structure Of Splsm567 Length = 94 | Back alignment and structure |
| >pdb|1LJO|A Chain A, Crystal Structure Of An Sm-Like Protein (Af-Sm2) From Archaeoglobus Fulgidus At 1.95a Resolution Length = 77 | Back alignment and structure |
| >pdb|3CW1|E Chain E, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 92 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 204 | |||
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 2e-28 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 3e-16 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 4e-25 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 6e-12 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 2e-24 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 5e-17 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 2e-24 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 3e-14 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 5e-22 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 2e-13 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 2e-21 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 1e-12 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 2e-21 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 8e-13 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 6e-19 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 5e-11 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 8e-19 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 2e-11 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 5e-18 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 1e-12 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 6e-17 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 5e-10 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 2e-15 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 5e-08 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 1e-14 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 7e-08 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 3e-14 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 1e-07 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 8e-14 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 2e-08 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 3e-13 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 1e-06 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 6e-12 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 5e-07 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 2e-11 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 2e-05 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 4e-11 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 1e-06 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 6e-11 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 6e-06 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 2e-08 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 5e-04 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 2e-08 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 6e-06 |
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 | Back alignment and structure |
|---|
Score = 101 bits (252), Expect = 2e-28
Identities = 40/85 (47%), Positives = 57/85 (67%), Gaps = 2/85 (2%)
Query: 102 YTMTAPSVATNPSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEY 161
+ S T+LPLEL+DKCIGS + +IMK+++E GTL GFDD+VN++L+DVTEY
Sbjct: 5 HHHHHHSQDPMSMTILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEY 64
Query: 162 ESTPEGRRITKLDQILLNGNNITML 186
++ K ++LLNGN + ML
Sbjct: 65 DTVTGVTE--KHSEMLLNGNGMCML 87
|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A Length = 94 | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E Length = 92 | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A Length = 121 | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 Length = 77 | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A Length = 83 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* Length = 75 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* Length = 77 | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} Length = 105 | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} Length = 96 | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} Length = 93 | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 Length = 81 | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F Length = 86 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B Length = 75 | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C Length = 113 | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Length = 126 | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D Length = 126 | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G Length = 76 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* Length = 81 | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A Length = 93 | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Length = 119 | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A Length = 119 | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Length = 75 | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 Length = 75 | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A Length = 91 | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B Length = 118 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 204 | |||
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 99.87 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 99.87 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 99.86 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 99.86 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 99.86 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 99.86 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 99.85 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 99.85 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 99.85 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 99.85 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 99.85 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 99.84 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 99.84 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 99.84 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 99.84 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 99.83 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 99.81 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 99.81 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 99.8 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 99.8 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 99.79 | |
| 1mgq_A | 83 | SM-like protein; LSM, RNA-binding, archea, RNA bin | 99.77 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 99.76 | |
| 4emk_A | 94 | U6 snRNA-associated SM-like protein LSM5; SM fold, | 99.75 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.75 | |
| 1n9r_A | 93 | SMF, small nuclear ribonucleoprotein F, snRNP-F, S | 99.74 | |
| 4emk_B | 75 | U6 snRNA-associated SM-like protein LSM6; SM fold, | 99.73 | |
| 1th7_A | 81 | SnRNP-2, small nuclear riboprotein protein; archae | 99.72 | |
| 1i8f_A | 81 | Putative snRNP SM-like protein; beta barrel-like S | 99.72 | |
| 3s6n_F | 86 | Small nuclear ribonucleoprotein F; SMN complex, SM | 99.71 | |
| 1ljo_A | 77 | Archaeal SM-like protein AF-SM2; snRNP, core snRNP | 99.71 | |
| 1h64_1 | 75 | SnRNP SM-like protein; SM fold, spliceosome, snRNP | 99.71 | |
| 3s6n_E | 92 | Small nuclear ribonucleoprotein E; SMN complex, SM | 99.7 | |
| 1d3b_A | 75 | Protein (small nuclear ribonucleoprotein SM D3); s | 99.69 | |
| 4emg_A | 93 | Probable U6 snRNA-associated SM-like protein LSM3; | 99.69 | |
| 1i4k_A | 77 | Putative snRNP SM-like protein; core snRNP domain, | 99.69 | |
| 3s6n_G | 76 | Small nuclear ribonucleoprotein G; SMN complex, SM | 99.68 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 99.68 | |
| 2fwk_A | 121 | U6 snRNA-associated SM-like protein LSM5; structur | 99.67 | |
| 3bw1_A | 96 | SMX4 protein, U6 snRNA-associated SM-like protein | 99.67 | |
| 4emk_C | 113 | U6 snRNA-associated SM-like protein LSM7; SM fold, | 99.64 | |
| 1d3b_B | 91 | Protein (small nuclear ribonucleoprotein associat | 99.61 | |
| 1b34_A | 119 | Protein (small nuclear ribonucleoprotein SM D1); s | 99.61 | |
| 4emh_A | 105 | Probable U6 snRNA-associated SM-like protein LSM4; | 99.61 | |
| 1b34_B | 118 | Protein (small nuclear ribonucleoprotein SM D2); s | 99.58 | |
| 2y9a_D | 126 | Small nuclear ribonucleoprotein SM D3; splicing-RN | 99.57 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 99.55 | |
| 1m5q_A | 130 | SMAP3, small nuclear ribonucleoprotein homolog, SM | 99.37 | |
| 1y96_A | 86 | Gemin6, SIP2, GEM-associated protein 6; SM fold, p | 98.27 | |
| 1y96_A | 86 | Gemin6, SIP2, GEM-associated protein 6; SM fold, p | 97.98 | |
| 1u1s_A | 82 | HFQ protein; SM-like bacterial protein, riken stru | 96.58 | |
| 2ylb_A | 74 | Protein HFQ; RNA-binding protein, LSM protein, RNA | 96.55 | |
| 3sb2_A | 79 | Protein HFQ; SM-like, RNA chaperone, chaperone; 2. | 96.29 | |
| 2y90_A | 104 | Protein HFQ; RNA-binding protein, SM-like, RNA cha | 96.27 | |
| 1kq1_A | 77 | HFQ, HOST factor for Q beta; hexamer, RNA binding | 96.27 | |
| 1u1s_A | 82 | HFQ protein; SM-like bacterial protein, riken stru | 96.26 | |
| 2ylb_A | 74 | Protein HFQ; RNA-binding protein, LSM protein, RNA | 96.23 | |
| 3ahu_A | 78 | Protein HFQ; SM-like motif, protein-RNA complex, t | 96.06 | |
| 3sb2_A | 79 | Protein HFQ; SM-like, RNA chaperone, chaperone; 2. | 96.05 | |
| 2qtx_A | 71 | Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi | 96.04 | |
| 2qtx_A | 71 | Uncharacterized protein MJ1435; HFQ, SM, RNA-bindi | 95.96 | |
| 1kq1_A | 77 | HFQ, HOST factor for Q beta; hexamer, RNA binding | 95.93 | |
| 2y90_A | 104 | Protein HFQ; RNA-binding protein, SM-like, RNA cha | 95.92 | |
| 3ahu_A | 78 | Protein HFQ; SM-like motif, protein-RNA complex, t | 95.91 | |
| 3hfo_A | 70 | SSR3341 protein; HFQ, SM, RNA-binding protein, sRN | 94.73 | |
| 3hfn_A | 72 | ASL2047 protein; HFQ, SM, RNA-binding protein, sRN | 94.38 | |
| 2vxe_A | 88 | CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA | 94.1 | |
| 1ycy_A | 71 | Conserved hypothetical protein; structural genomic | 92.06 | |
| 2fb7_A | 95 | SM-like protein, LSM-14_N (RAP55); DR.13312, BC055 | 91.6 | |
| 1y96_B | 85 | Gemin7, SIP3, GEM-associated protein 7; SM fold, p | 91.5 | |
| 3hfn_A | 72 | ASL2047 protein; HFQ, SM, RNA-binding protein, sRN | 90.55 | |
| 4a53_A | 125 | EDC3; RNA binding protein; NMR {Schizosaccharomyce | 90.53 | |
| 3hfo_A | 70 | SSR3341 protein; HFQ, SM, RNA-binding protein, sRN | 89.51 | |
| 1ycy_A | 71 | Conserved hypothetical protein; structural genomic | 89.35 | |
| 2vc8_A | 84 | Enhancer of mRNA-decapping protein 3; P-BODY compo | 83.62 |
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A | Back alignment and structure |
|---|
Probab=99.87 E-value=3.5e-22 Score=149.33 Aligned_cols=75 Identities=52% Similarity=0.873 Sum_probs=66.5
Q ss_pred CCCCCcHHHHHhhcCCEEEEEEeCCeEEEEEEEEEcCccceEEcceEEEeecCCCeeeeeeCeEEEeCCcEEEEccc
Q psy800 113 PSTLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTPEGRRITKLDQILLNGNNITMLGLH 189 (204)
Q Consensus 113 ~~~~~Pl~~L~~~i~k~V~V~Lk~gr~i~G~L~gfD~~mNlVL~da~E~~~~~~~~~~~~lg~ilIRGdnI~~I~~~ 189 (204)
.....|+++|.++++++|+|+|++|++|+|+|+|||+||||||+||+|+.. +++..+.+|.++|||+||++|++.
T Consensus 16 ~~~~~Pl~lL~~~l~k~V~V~Lk~gr~~~G~L~gfD~~mNlvL~d~~E~~~--~~~~~~~lg~v~IRG~nI~~i~p~ 90 (94)
T 4emk_A 16 SMTILPLELIDKCIGSNLWVIMKSEREFAGTLVGFDDYVNIVLKDVTEYDT--VTGVTEKHSEMLLNGNGMCMLIPG 90 (94)
T ss_dssp ----CHHHHHHHTTTSEEEEEESSSEEEEEEEEEECTTCCEEEEEEEEEET--TTCCEEEEEEEEECSTTEEEEEEC
T ss_pred cccccCHHHHHHHcCCeEEEEECCCcEEEEEEEEEcccCCeEeeeEEEEec--CCCcEeEcCEEEEcCCEEEEEEeC
Confidence 346789999999999999999999999999999999999999999999973 334688999999999999999876
|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B | Back alignment and structure |
|---|
| >1mgq_A SM-like protein; LSM, RNA-binding, archea, RNA binding protein; 1.70A {Methanothermobacterthermautotrophicus} SCOP: b.38.1.1 PDB: 1i81_A 1loj_A* 1jbm_A 1jri_A | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D | Back alignment and structure |
|---|
| >4emk_A U6 snRNA-associated SM-like protein LSM5; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_A | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A | Back alignment and structure |
|---|
| >1n9r_A SMF, small nuclear ribonucleoprotein F, snRNP-F, SM protein F; heptamer, translation; 2.80A {Saccharomyces cerevisiae} SCOP: b.38.1.1 PDB: 1n9s_A | Back alignment and structure |
|---|
| >4emk_B U6 snRNA-associated SM-like protein LSM6; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_B | Back alignment and structure |
|---|
| >1th7_A SnRNP-2, small nuclear riboprotein protein; archaea, SM protein, SM fold, SS-SM1, RNA binding protein; 1.68A {Sulfolobus solfataricus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1i8f_A Putative snRNP SM-like protein; beta barrel-like SMAP monomers form 35-stranded beta-sheet I heptamer, structural genomics; 1.75A {Pyrobaculum aerophilum} SCOP: b.38.1.1 PDB: 1lnx_A* | Back alignment and structure |
|---|
| >3s6n_F Small nuclear ribonucleoprotein F; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_F 2y9c_F 2y9d_F 3cw1_F 3pgw_F* 2y9a_F | Back alignment and structure |
|---|
| >1ljo_A Archaeal SM-like protein AF-SM2; snRNP, core snRNP domain, RNA binding protein, unknown F; 1.95A {Archaeoglobus fulgidus} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1h64_1 SnRNP SM-like protein; SM fold, spliceosome, snRNP core; 1.9A {Pyrococcus abyssi} SCOP: b.38.1.1 PDB: 1m8v_A* | Back alignment and structure |
|---|
| >3s6n_E Small nuclear ribonucleoprotein E; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_E 2y9c_E 2y9d_E 3cw1_E 3pgw_E* 2y9a_E | Back alignment and structure |
|---|
| >1d3b_A Protein (small nuclear ribonucleoprotein SM D3); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >4emg_A Probable U6 snRNA-associated SM-like protein LSM3; SM fold, mRNA decay, LSM proteins, RNA binding protein; 2.70A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1i4k_A Putative snRNP SM-like protein; core snRNP domain, RNA binding protein; HET: CIT; 2.50A {Archaeoglobus fulgidus} SCOP: b.38.1.1 PDB: 1i5l_A* | Back alignment and structure |
|---|
| >3s6n_G Small nuclear ribonucleoprotein G; SMN complex, SMN-gemin2 complex, U-rich snRNA, SM fold, SM C SNRNPS, snRNP biogenesis, PRE-mRNA splicing; 2.50A {Homo sapiens} PDB: 2y9b_G 2y9c_G 2y9d_G 3cw1_G 3pgw_G* 2y9a_G | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >2fwk_A U6 snRNA-associated SM-like protein LSM5; structural genomics, structural genomics consortium, SGC, DNA binding protein; 2.14A {Cryptosporidium parvum} SCOP: b.38.1.1 PDB: 3pgg_A | Back alignment and structure |
|---|
| >3bw1_A SMX4 protein, U6 snRNA-associated SM-like protein LSM3; RNA-binding protein, SM protein, ring, HOMO octamer, mRNA processing; 2.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4emk_C U6 snRNA-associated SM-like protein LSM7; SM fold, mRNA decay and PRE-mRNA splicing, LSM proteins, RNA protein; 2.30A {Schizosaccharomyces pombe} PDB: 3swn_C | Back alignment and structure |
|---|
| >1d3b_B Protein (small nuclear ribonucleoprotein associat B); snRNP, splicing, core snRNP domain, systemic lupus eryth SLE, RNA binding protein; HET: CIT; 2.00A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_A 2y9b_A 2y9c_A 2y9d_A | Back alignment and structure |
|---|
| >1b34_A Protein (small nuclear ribonucleoprotein SM D1); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_B 2y9b_B 2y9c_B 2y9d_B 3cw1_B 3pgw_X* 3s6n_A | Back alignment and structure |
|---|
| >4emh_A Probable U6 snRNA-associated SM-like protein LSM4; SM fold, mRNA decay, PRE-mRNA splicing, LSM proteins, RNA BI protein; 2.20A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >1b34_B Protein (small nuclear ribonucleoprotein SM D2); snRNP, splicing, spliceosome, core snRNP domain, systemi erythematosus, SLE, RNA binding protein; 2.50A {Homo sapiens} SCOP: b.38.1.1 PDB: 2y9a_C 2y9b_C 2y9c_C 2y9d_C 3cw1_C 3pgw_Y* 3s6n_B | Back alignment and structure |
|---|
| >2y9a_D Small nuclear ribonucleoprotein SM D3; splicing-RNA complex, PRE-mRNA splicing, spliceosome, snRNP biogenesis, SM site, SM fold, heteromeric heptameric ring; 3.60A {Homo sapiens} PDB: 2y9b_D 2y9c_D 2y9d_D 3pgw_Z* 3cw1_D | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A | Back alignment and structure |
|---|
| >1m5q_A SMAP3, small nuclear ribonucleoprotein homolog, SM-like P; OB-like fold, B-sheet toroid, 14-MER, cadmium-binding site, translation; 2.00A {Pyrobaculum aerophilum} SCOP: b.38.1.1 | Back alignment and structure |
|---|
| >1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1y96_A Gemin6, SIP2, GEM-associated protein 6; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A | Back alignment and structure |
|---|
| >2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* | Back alignment and structure |
|---|
| >3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 | Back alignment and structure |
|---|
| >2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A | Back alignment and structure |
|---|
| >1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A | Back alignment and structure |
|---|
| >1u1s_A HFQ protein; SM-like bacterial protein, riken structural genomics/proteomics initiative, RSGI, structural genomics, RNA binding protein; 1.60A {Pseudomonas aeruginosa} SCOP: b.38.1.2 PDB: 1u1t_A 3qui_A* 3m4g_A 3inz_A | Back alignment and structure |
|---|
| >2ylb_A Protein HFQ; RNA-binding protein, LSM protein, RNA chaperone; 1.15A {Salmonella enterica subsp} PDB: 2yht_A 1hk9_A 2ylc_A* 3gib_A* 3rer_A* 3qo3_A* 3res_A* | Back alignment and structure |
|---|
| >3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A | Back alignment and structure |
|---|
| >3sb2_A Protein HFQ; SM-like, RNA chaperone, chaperone; 2.63A {Herbaspirillum seropedicae} SCOP: b.38.1.2 | Back alignment and structure |
|---|
| >2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qtx_A Uncharacterized protein MJ1435; HFQ, SM, RNA-binding protein, sRNA, translational regulation, RNA binding protein; 2.50A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1kq1_A HFQ, HOST factor for Q beta; hexamer, RNA binding protein, translational regulator, SM motif; 1.55A {Staphylococcus aureus} SCOP: b.38.1.2 PDB: 1kq2_A | Back alignment and structure |
|---|
| >2y90_A Protein HFQ; RNA-binding protein, SM-like, RNA chaperone; 2.25A {Escherichia coli} PDB: 3qhs_A | Back alignment and structure |
|---|
| >3ahu_A Protein HFQ; SM-like motif, protein-RNA complex, translation-RNA complex; 2.20A {Bacillus subtilis} PDB: 3hsb_A | Back alignment and structure |
|---|
| >3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} | Back alignment and structure |
|---|
| >3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} | Back alignment and structure |
|---|
| >2vxe_A CG10686-PA; EDC3, CAR-1, P-bodies, decapping, mRNA decay, LSM proteins, translational repression, transcription; NMR {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 | Back alignment and structure |
|---|
| >2fb7_A SM-like protein, LSM-14_N (RAP55); DR.13312, BC055387, AAH55387, stronGly BENT five-stranded antiparallel beta- sheet, structural genomics, PSI; NMR {Danio rerio} SCOP: b.38.1.5 PDB: 2vxf_A | Back alignment and structure |
|---|
| >1y96_B Gemin7, SIP3, GEM-associated protein 7; SM fold, protein complex, RNA binding protein; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3hfn_A ASL2047 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 2.31A {Nostoc SP} | Back alignment and structure |
|---|
| >4a53_A EDC3; RNA binding protein; NMR {Schizosaccharomyces pombe} PDB: 4a54_A | Back alignment and structure |
|---|
| >3hfo_A SSR3341 protein; HFQ, SM, RNA-binding protein, sRNA, translational regulation binding protein; 1.30A {Synechocystis SP} | Back alignment and structure |
|---|
| >1ycy_A Conserved hypothetical protein; structural genomics, southeast collaboratory for structural genomics, secsg, protein structure initiative; 2.80A {Pyrococcus furiosus} SCOP: b.38.1.4 | Back alignment and structure |
|---|
| >2vc8_A Enhancer of mRNA-decapping protein 3; P-BODY component, cytoplasm, SM-like protein, protein-binding; 1.31A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 204 | ||||
| d2fwka1 | 92 | b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr | 2e-18 | |
| d2fwka1 | 92 | b.38.1.1 (A:24-115) U6 snRNA-associated sm-like pr | 2e-12 | |
| d1ljoa_ | 75 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 5e-16 | |
| d1ljoa_ | 75 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 7e-10 | |
| d1mgqa_ | 74 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-15 | |
| d1mgqa_ | 74 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 2e-09 | |
| d1h641_ | 71 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 3e-15 | |
| d1h641_ | 71 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 8e-10 | |
| d1i4k1_ | 72 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 3e-15 | |
| d1i4k1_ | 72 | b.38.1.1 (1:) Archaeal homoheptameric Sm protein { | 3e-09 | |
| d1th7a1 | 76 | b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote | 6e-15 | |
| d1th7a1 | 76 | b.38.1.1 (A:3-78) Archaeal homoheptameric Sm prote | 6e-09 | |
| d1d3ba_ | 72 | b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s | 3e-14 | |
| d1d3ba_ | 72 | b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo s | 1e-09 | |
| d1m5q1_ | 127 | b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch | 3e-12 | |
| d1m5q1_ | 127 | b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Arch | 1e-08 | |
| d1d3bb_ | 81 | b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa | 6e-12 | |
| d1d3bb_ | 81 | b.38.1.1 (B:) B core SNRNP protein {Human (Homo sa | 5e-07 | |
| d1b34b_ | 93 | b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s | 6e-12 | |
| d1b34b_ | 93 | b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo s | 4e-08 | |
| d1i8fa_ | 71 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 7e-12 | |
| d1i8fa_ | 71 | b.38.1.1 (A:) Archaeal homoheptameric Sm protein { | 3e-07 | |
| d1n9ra_ | 68 | b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S | 3e-11 | |
| d1n9ra_ | 68 | b.38.1.1 (A:) Small nuclear ribonucleoprotein F, S | 2e-05 | |
| d1b34a_ | 80 | b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s | 4e-10 | |
| d1b34a_ | 80 | b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo s | 7e-05 |
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: U6 snRNA-associated sm-like protein LSM5 species: Cryptosporidium parvum [TaxId: 5807]
Score = 74.1 bits (182), Expect = 2e-18
Identities = 39/85 (45%), Positives = 56/85 (65%), Gaps = 12/85 (14%)
Query: 114 STLLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTPEGRRIT-- 171
+ +LPL L+DKCIG+RI+++MK DKE G L GFD++VNM+L+DV EY + I+
Sbjct: 2 NIILPLALIDKCIGNRIYVVMKGDKEFSGVLRGFDEYVNMVLDDVQEYGFKADEEDISGG 61
Query: 172 ----------KLDQILLNGNNITML 186
+L+ ILL+GNN+ ML
Sbjct: 62 NKKLKRVMVNRLETILLSGNNVAML 86
|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} Length = 92 | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} Length = 75 | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 74 | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} Length = 71 | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} Length = 72 | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} Length = 76 | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 72 | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 127 | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 81 | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 71 | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 68 | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 204 | |||
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 99.87 | |
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.87 | |
| d1ljoa_ | 75 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.86 | |
| d1mgqa_ | 74 | Archaeal homoheptameric Sm protein {Archaeon Metha | 99.86 | |
| d2fwka1 | 92 | U6 snRNA-associated sm-like protein LSM5 {Cryptosp | 99.84 | |
| d1b34b_ | 93 | D2 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.83 | |
| d1i8fa_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyrob | 99.83 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 99.82 | |
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.8 | |
| d1n9ra_ | 68 | Small nuclear ribonucleoprotein F, Smf {Baker's ye | 99.8 | |
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 99.78 | |
| d1h641_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyroc | 99.71 | |
| d1i4k1_ | 72 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.71 | |
| d1ljoa_ | 75 | Archaeal homoheptameric Sm protein {Archaeon Archa | 99.7 | |
| d1mgqa_ | 74 | Archaeal homoheptameric Sm protein {Archaeon Metha | 99.7 | |
| d1b34a_ | 80 | D1 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.68 | |
| d1th7a1 | 76 | Archaeal homoheptameric Sm protein {Sulfolobus sol | 99.67 | |
| d2fwka1 | 92 | U6 snRNA-associated sm-like protein LSM5 {Cryptosp | 99.63 | |
| d1i8fa_ | 71 | Archaeal homoheptameric Sm protein {Archaeon Pyrob | 99.59 | |
| d1d3ba_ | 72 | D3 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.59 | |
| d1n9ra_ | 68 | Small nuclear ribonucleoprotein F, Smf {Baker's ye | 99.58 | |
| d1m5q1_ | 127 | Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul | 99.56 | |
| d1b34b_ | 93 | D2 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.54 | |
| d1d3bb_ | 81 | B core SNRNP protein {Human (Homo sapiens) [TaxId: | 99.49 | |
| d1b34a_ | 80 | D1 core SNRNP protein {Human (Homo sapiens) [TaxId | 99.37 | |
| d1m5q1_ | 127 | Sm-Like archaeal protein Smap3 {Archaeon Pyrobacul | 99.18 | |
| d1u1sa1 | 66 | Pleiotropic translational regulator Hfq {Pseudomon | 95.97 | |
| d1u1sa1 | 66 | Pleiotropic translational regulator Hfq {Pseudomon | 95.83 | |
| d1kq1a_ | 60 | Pleiotropic translational regulator Hfq {Staphyloc | 95.44 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 95.22 | |
| d1kq1a_ | 60 | Pleiotropic translational regulator Hfq {Staphyloc | 94.7 | |
| d2vxfa1 | 80 | LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) | 93.88 | |
| d1ycya1 | 66 | Hypothetical protein PF1955 {Pyrococcus furiosus [ | 92.29 | |
| d1ycya1 | 66 | Hypothetical protein PF1955 {Pyrococcus furiosus [ | 90.02 | |
| d1biaa2 | 47 | Biotin repressor/biotin holoenzyme synthetase, C-t | 88.61 | |
| d1ib8a1 | 74 | Hypothetical protein SP14.3 (SP0552) {Streptococcu | 82.19 |
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Sm-like fold superfamily: Sm-like ribonucleoproteins family: Sm motif of small nuclear ribonucleoproteins, SNRNP domain: Archaeal homoheptameric Sm protein species: Archaeon Pyrococcus abyssi [TaxId: 29292]
Probab=99.87 E-value=2.7e-22 Score=140.46 Aligned_cols=71 Identities=23% Similarity=0.516 Sum_probs=65.9
Q ss_pred CCcHHHHHhhcCCEEEEEEeCCeEEEEEEEEEcCccceEEcceEEEeecCCCeeeeeeCeEEEeCCcEEEEccc
Q psy800 116 LLPLELVDKCIGSRIHIIMKNDKEIVGTLNGFDDFVNMLLEDVTEYESTPEGRRITKLDQILLNGNNITMLGLH 189 (204)
Q Consensus 116 ~~Pl~~L~~~i~k~V~V~Lk~gr~i~G~L~gfD~~mNlVL~da~E~~~~~~~~~~~~lg~ilIRGdnI~~I~~~ 189 (204)
+.|+++|+++++++|+|+|+||+.|+|+|.+||+|||++|+||.|.. ++++.+++|.++|||++|++|+|.
T Consensus 1 ~~Pl~~L~~~~~~~V~V~lk~g~~~~G~L~~~D~~mNlvL~~~~e~~---~~~~~~~l~~~~IRG~~I~~Isp~ 71 (71)
T d1h641_ 1 ERPLDVIHRSLDKDVLVILKKGFEFRGRLIGYDIHLNVVLADAEMIQ---DGEVVKRYGKIVIRGDNVLAISPT 71 (71)
T ss_dssp CCHHHHHHTTTTSEEEEEETTSEEEEEEEEEECTTCCEEEEEEEEEE---TTEEEEEEEEEEECGGGEEEEEEC
T ss_pred CCchHHHHHhCCCEEEEEEcCCCEEEEEEEEECCCCCeEEeeEEEEe---cCCcEeEcCcEEEECCeEEEEeCC
Confidence 36999999999999999999999999999999999999999999986 345688999999999999999874
|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h641_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1i4k1_ b.38.1.1 (1:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm1 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ljoa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Archaeoglobus fulgidus, AF-Sm2 [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mgqa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1th7a1 b.38.1.1 (A:3-78) Archaeal homoheptameric Sm protein {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d2fwka1 b.38.1.1 (A:24-115) U6 snRNA-associated sm-like protein LSM5 {Cryptosporidium parvum [TaxId: 5807]} | Back information, alignment and structure |
|---|
| >d1i8fa_ b.38.1.1 (A:) Archaeal homoheptameric Sm protein {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1d3ba_ b.38.1.1 (A:) D3 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n9ra_ b.38.1.1 (A:) Small nuclear ribonucleoprotein F, Smf {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1b34b_ b.38.1.1 (B:) D2 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d3bb_ b.38.1.1 (B:) B core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b34a_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m5q1_ b.38.1.1 (1:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1u1sa1 b.38.1.2 (A:6-71) Pleiotropic translational regulator Hfq {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kq1a_ b.38.1.2 (A:) Pleiotropic translational regulator Hfq {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d2vxfa1 b.38.1.5 (A:6-85) LSM14 homolog A (Lsm14a) {Zebrafish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ycya1 b.38.1.4 (A:5-70) Hypothetical protein PF1955 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ib8a1 b.38.2.1 (A:91-164) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|