Diaphorina citri psyllid: psy8033


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------
MTARFEALNRALCINVGDSKIVGRIESYSCKMAGNDKQFYKKFNSEQGTTPQDLQALSPPQSGLGISPGRSHYRIESYSCKMAGNDKQFYKKFNSEQGTTPQDLQALSPPQSGLGISPGRSHYSYSCKMAGNDKQFYKKFNSEQGTTPQDLQALSPPQSGLGISPVAASLVMRKVLYWVMNAIDSNLSTTAGEQYRTLRPHLWAALEDEIVLPECDIYSYNPDLTSDPFSEDGSLWSFNYFFYNKKLKRIVFFSCRAINLIKGGVNA
cccHHHHHHHHcccccccCEEEEEEEEEECcccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHccccccccEEEEEcccccccccccccccEEEEEEEEEccccEEEEEEEEEEEEccccccc
**ARFEALNRALCINVGDSKIVGRIESYSCKMAGNDKQFYKKFN*********************************************************************************************KKFNSEQGTTPQDLQALSPPQS**GISPVAASLVMRKVLYWVMNAIDSNLSTTAGEQYRTLRPHLWAALEDEIVLPECDIYSYNPDLTSDPFSEDGSLWSFNYFFYNKKLKRIVFFSCRAINLIK*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTARFEALNRALCINVGDSKIVGRIESYSCKMAGNDKQFYKKFNSEQGTTPQDLQALSPPQSGLGISPGRSHYRIESYSCKMAGNDKQFYKKFNSEQGTTPQDLQALSPPQSGLGISPGRSHYSYSCKMAGNDKQFYKKFNSEQGTTPQDLQALSPPQSGLGISPVAASLVMRKVLYWVMNAIDSNLSTTAGEQYRTLRPHLWAALEDEIVLPECDIYSYNPDLTSDPFSEDGSLWSFNYFFYNKKLKRIVFFSCRAINLIKGGVNA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Repressor of RNA polymerase III transcription MAF1 homolog Element of the TORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA.confidentQ6PGU2
Repressor of RNA polymerase III transcription MAF1 homolog Element of the mTORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA.confidentA5D9C6
Repressor of RNA polymerase III transcription MAF1 homolog Element of the mTORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA.confidentQ9H063

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0060077 [CC]inhibitory synapseprobableGO:0005575, GO:0045202
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0001030 [MF]RNA polymerase III type 1 promoter DNA bindingprobableGO:0044212, GO:0080084, GO:0000182, GO:0043565, GO:0001016, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0001031 [MF]RNA polymerase III type 2 promoter DNA bindingprobableGO:0044212, GO:0001016, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0001032 [MF]RNA polymerase III type 3 promoter DNA bindingprobableGO:0044212, GO:0001016, GO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0016480 [BP]negative regulation of transcription from RNA polymerase III promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006359, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3NR5, chain A
Confidence level:very confident
Coverage over the Query: 2-31,60-61,79,97-129,167-257
View the alignment between query and template
View the model in PyMOL