Diaphorina citri psyllid: psy8037


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290--
MLIRTVIPCADGVKTVNRESSAPFKPVIPRELAHQRPGRLDIILDMPPASRETQVKHAWNPEDRSLNIFVKDDDKLTFHRHPVAQSTDCIRGRVGFTKGFHIWEVHWSARQRGTHAVVGVGTIDAPLHSVGYQSLVGSNDQSWGWDLGRNRLYHDSKNNTGLTYPTLLKPDETFVVPDKFLVILDMDEGTLSFVVDGQYLGVAFRGLKGRKLYPIVSAVWGHCEITMKYIGGLDLILDMDEGTLSFVVDGQYLGVAFRGLKGRKLYPIVSAVWGHCEITMKYIGGLDPQSEA
ccccEEEEcccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccEEEEcccEEEEECccccccccCEECcCCccccEEEEEEEEEECcccccEEEccccccccccccccccccccccccccCEcccccEEEccccccccccccccccccccccccEEEEEEEccccEEEEEEccEEEEccccccccccEEEEEEEEccccEEEEEEEccccccccccccEEEEEccccccccccccccccccccEEEEEEcccEEEEEEcccccccccc
*LIRTVIPCADGV**************************LDIIL****ASRETQVKHAWNPEDRSLNIFVKDDDKLTFHRHPVAQSTDCIRGRVGFTKGFHIWEVHWSARQRGTHAVVGVGTIDAPLHSVGYQSLVGSNDQSWGWDLGRNRLYHDSKNNTGLTYPTLLKPDETFVVPDKFLVILDMDEGTLSFVVDGQYLGVAFRGLKGRKLYPIVSAVWGHCEITMKYIGGLDLILDMDEGTLSFVVDGQYLGVAFRGLKGRKLYPIVSAVWGHCEITMKYIGGL******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLIRTVIPCADGVKTVNRESSAPFKPVIPRELAHQRPGRLDIILDMPPASRETQVKHAWNPEDRSLNIFVKDDDKLTFHRHPVAQSTDCIRGRVGFTKGFHIWEVHWSARQRGTHAVVGVGTIDAPLHSVGYQSLVGSNDQSWGWDLGRNRLYHDSKNNTGLTYPTLLKPDETFVVPDKFLVILDMDEGTLSFVVDGQYLGVAFRGLKGRKLYPIVSAVWGHCEITMKYIGGLDLILDMDEGTLSFVVDGQYLGVAFRGLKGRKLYPIVSAVWGHCEITMKYIGGLDPQSEA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
SPRY domain-containing SOCS box protein 4 Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.very confidentQ8R5B6
SPRY domain-containing SOCS box protein 1 Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.confidentQ5E9X6
SPRY domain-containing SOCS box protein 1 Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.confidentQ96BD6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0046843 [BP]dorsal appendage formationprobableGO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0007292, GO:0007304, GO:0007306, GO:0009653, GO:0044699, GO:0007276, GO:0000003, GO:0030703, GO:0030707, GO:0016043, GO:0032989, GO:0071840, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0044763
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0007314 [BP]oocyte anterior/posterior axis specificationprobableGO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0008595, GO:0000003, GO:0009948, GO:0048869, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0044767, GO:0044702, GO:0009952, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043161 [BP]proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0006974 [BP]response to DNA damage stimulusprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0014069 [CC]postsynaptic densityprobableGO:0030425, GO:0043229, GO:0043228, GO:0044430, GO:0044327, GO:0043226, GO:0005856, GO:0044446, GO:0044309, GO:0097458, GO:0044456, GO:0043005, GO:0042995, GO:0043197, GO:0043232, GO:0044463, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044422, GO:0045202
GO:0042787 [BP]protein ubiquitination involved in ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0070647, GO:0032446, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0044237, GO:0043170, GO:0016567, GO:0006511

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JK9, chain A
Confidence level:very confident
Coverage over the Query: 35-234
View the alignment between query and template
View the model in PyMOL
Template: 2AFJ, chain A
Confidence level:confident
Coverage over the Query: 236-291
View the alignment between query and template
View the model in PyMOL