Diaphorina citri psyllid: psy8039


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MSSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILDHNSE
cccHHHHHHHHHHcccccccccccccccHHcccccccEEEEEEEccccEEEEcccccccccHHccHHHHHHHHHHHccHHHHHHHcccccccccccEEEEccccc
*SSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILD****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILDHNSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glutaminase kidney isoform, mitochondrial Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity.confidentO94925
Glutaminase confidentQ8NMT3
Glutaminase confidentQ8FMX4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051289 [BP]protein homotetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0051260, GO:0051262, GO:0065003, GO:0044085, GO:0008150, GO:0016043, GO:0071840
GO:0050789 [BP]regulation of biological processprobableGO:0008150, GO:0065007
GO:0007268 [BP]synaptic transmissionprobableGO:0044700, GO:0019226, GO:0032501, GO:0044707, GO:0035637, GO:0050877, GO:0009987, GO:0008150, GO:0044763, GO:0023052, GO:0007267, GO:0007154, GO:0044699, GO:0003008
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006520 [BP]cellular amino acid metabolic processprobableGO:0044238, GO:0044710, GO:1901564, GO:0006082, GO:0044237, GO:0009987, GO:0019752, GO:0071704, GO:0006807, GO:0008150, GO:0044281, GO:0008152, GO:0043436
GO:0005759 [CC]mitochondrial matrixprobableGO:0005737, GO:0005575, GO:0043231, GO:0043233, GO:0031974, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0044446, GO:0070013, GO:0044444, GO:0044429, GO:0044424, GO:0005623, GO:0043227, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UO9, chain A
Confidence level:very confident
Coverage over the Query: 5-104
View the alignment between query and template
View the model in PyMOL