Psyllid ID: psy8039

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MSSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILDHNSE
cccHHHHHHHHHHcccccccccccccccHHcccccccEEEEEEEccccEEEEcccccccccHHccHHHHHHHHHHHccHHHHHHHcccccccccccEEEEccccc
cccHHHHHHHHHHHHHccccccHHHHHHHHHccccccEEEEEEEEccEEEEEccccccEEEEHHHHHHHHHHHHHHccHHHHHHHcccccccccHHHHEEccccc
mssdqcvqsskfsNKVQLFLRQVADYIPqlaradpkywgvsvctvdgqrysigktnipftiqscskPLTYAIALEeldqeevhkyvgqepsgrnfNELILDHNSE
mssdqcvqsskfsnKVQLFLRQVADYIPQlaradpkywgVSVCTVDGQrysigktnipftiqsCSKPLTYAIALEELDQEEVHKyvgqepsgrnfnelildhnse
MSSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILDHNSE
*************NKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYV*******************
*SSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILD****
***********FSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILDHNSE
*SSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPSGRNFNELILDHNSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
D3Z7P3 674 Glutaminase kidney isofor yes N/A 0.8 0.124 0.630 2e-27
P13264 674 Glutaminase kidney isofor no N/A 0.8 0.124 0.630 2e-27
O94925 669 Glutaminase kidney isofor yes N/A 0.8 0.125 0.619 9e-27
Q9UI32 602 Glutaminase liver isoform no N/A 0.857 0.149 0.566 7e-26
P28492 602 Glutaminase liver isoform no N/A 0.857 0.149 0.555 2e-25
Q571F8 602 Glutaminase liver isoform no N/A 0.761 0.132 0.6 4e-25
Q19013 605 Putative glutaminase DH11 yes N/A 0.761 0.132 0.612 1e-22
Q93650 583 Putative glutaminase F30F no N/A 0.790 0.142 0.542 8e-22
Q89NA7 613 Glutaminase 1 OS=Bradyrhi yes N/A 0.780 0.133 0.487 1e-18
Q8NMT3 413 Glutaminase OS=Corynebact yes N/A 0.761 0.193 0.537 3e-18
>sp|D3Z7P3|GLSK_MOUSE Glutaminase kidney isoform, mitochondrial OS=Mus musculus GN=Gls PE=1 SV=1 Back     alignment and function desciption
 Score =  120 bits (302), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (78%)

Query: 22  QVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEE 81
           +VADYIPQLA+  P  WGVSVCTVDGQR+SIG T +PF +QSC KPL YAIA+ +L  E 
Sbjct: 250 KVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEY 309

Query: 82  VHKYVGQEPSGRNFNELILDHNSE 105
           VH+YVG+EPSG  FN+L L+ + +
Sbjct: 310 VHRYVGKEPSGLRFNKLFLNEDDK 333
Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 2
>sp|P13264|GLSK_RAT Glutaminase kidney isoform, mitochondrial OS=Rattus norvegicus GN=Gls PE=1 SV=2 Back     alignment and function description
>sp|O94925|GLSK_HUMAN Glutaminase kidney isoform, mitochondrial OS=Homo sapiens GN=GLS PE=1 SV=1 Back     alignment and function description
>sp|Q9UI32|GLSL_HUMAN Glutaminase liver isoform, mitochondrial OS=Homo sapiens GN=GLS2 PE=1 SV=2 Back     alignment and function description
>sp|P28492|GLSL_RAT Glutaminase liver isoform, mitochondrial OS=Rattus norvegicus GN=Gls2 PE=2 SV=3 Back     alignment and function description
>sp|Q571F8|GLSL_MOUSE Glutaminase liver isoform, mitochondrial OS=Mus musculus GN=Gls2 PE=2 SV=2 Back     alignment and function description
>sp|Q19013|GLSA_CAEEL Putative glutaminase DH11.1 OS=Caenorhabditis elegans GN=DH11.1 PE=3 SV=2 Back     alignment and function description
>sp|Q93650|GLSB_CAEEL Putative glutaminase F30F8.2 OS=Caenorhabditis elegans GN=F30F8.2 PE=3 SV=2 Back     alignment and function description
>sp|Q89NA7|GLSA1_BRAJA Glutaminase 1 OS=Bradyrhizobium japonicum (strain USDA 110) GN=glsA1 PE=3 SV=1 Back     alignment and function description
>sp|Q8NMT3|GLSA_CORGL Glutaminase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=glsA PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
345479103 660 PREDICTED: glutaminase kidney isoform, m 0.8 0.127 0.809 7e-36
307191532 616 Glutaminase kidney isoform, mitochondria 0.8 0.136 0.773 3e-34
380012339 637 PREDICTED: glutaminase kidney isoform, m 0.8 0.131 0.773 4e-34
328787998 638 PREDICTED: glutaminase kidney isoform, m 0.8 0.131 0.773 4e-34
383848767 636 PREDICTED: glutaminase kidney isoform, m 0.8 0.132 0.773 4e-34
340718862 636 PREDICTED: glutaminase kidney isoform, m 0.8 0.132 0.773 5e-34
350419763 636 PREDICTED: glutaminase kidney isoform, m 0.8 0.132 0.773 5e-34
340718860 583 PREDICTED: glutaminase kidney isoform, m 0.8 0.144 0.773 8e-34
350419766 583 PREDICTED: glutaminase kidney isoform, m 0.8 0.144 0.773 8e-34
270014589 625 hypothetical protein TcasGA2_TC004628 [T 0.8 0.134 0.761 1e-33
>gi|345479103|ref|XP_001601673.2| PREDICTED: glutaminase kidney isoform, mitochondrial-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  154 bits (389), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 68/84 (80%), Positives = 76/84 (90%)

Query: 22  QVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEE 81
           +VA YIPQLAR +P+YWGVSVCT+DGQR+SIG T IPFT+QSCSKPLTYAIALE L QE 
Sbjct: 202 KVASYIPQLARMNPEYWGVSVCTIDGQRFSIGDTTIPFTLQSCSKPLTYAIALERLGQEV 261

Query: 82  VHKYVGQEPSGRNFNELILDHNSE 105
           VHKYVGQEPSGRNFNEL+LDHN +
Sbjct: 262 VHKYVGQEPSGRNFNELVLDHNKK 285

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307191532|gb|EFN75035.1| Glutaminase kidney isoform, mitochondrial [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380012339|ref|XP_003690243.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like [Apis florea] Back     alignment and taxonomy information
>gi|328787998|ref|XP_392523.4| PREDICTED: glutaminase kidney isoform, mitochondrial isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383848767|ref|XP_003700019.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340718862|ref|XP_003397882.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350419763|ref|XP_003492293.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340718860|ref|XP_003397881.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350419766|ref|XP_003492294.1| PREDICTED: glutaminase kidney isoform, mitochondrial-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
>gi|270014589|gb|EFA11037.1| hypothetical protein TcasGA2_TC004628 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
FB|FBgn0261625 775 CG42708 [Drosophila melanogast 0.819 0.110 0.697 1.1e-29
UNIPROTKB|F1SN47 470 GLS "Uncharacterized protein" 0.8 0.178 0.630 2.4e-25
UNIPROTKB|H7BZD1114 GLS "Glutaminase kidney isofor 0.8 0.736 0.619 3.6e-25
UNIPROTKB|F1LR09 567 Gls "Glutaminase kidney isofor 0.8 0.148 0.630 5.5e-25
UNIPROTKB|F1NHM6 486 GLS "Uncharacterized protein" 0.8 0.172 0.607 8.2e-25
UNIPROTKB|F1MM79 603 GLS "Uncharacterized protein" 0.8 0.139 0.619 8.6e-25
MGI|MGI:95752 674 Gls "glutaminase" [Mus musculu 0.8 0.124 0.630 9e-25
RGD|2707 674 Gls "glutaminase" [Rattus norv 0.8 0.124 0.630 9e-25
UNIPROTKB|P13264 674 Gls "Glutaminase kidney isofor 0.8 0.124 0.630 9e-25
UNIPROTKB|E2RJ93 754 GLS "Uncharacterized protein" 0.8 0.111 0.630 1.2e-24
FB|FBgn0261625 CG42708 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 338 (124.0 bits), Expect = 1.1e-29, P = 1.1e-29
 Identities = 60/86 (69%), Positives = 74/86 (86%)

Query:    20 LRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQ 79
             L ++ADYIPQLAR +P  WG+S+CT+DGQR+SIG  ++PFT+QSCSKPLTYAIALE+L  
Sbjct:   222 LGKLADYIPQLARYNPDSWGLSICTIDGQRFSIGDVDVPFTLQSCSKPLTYAIALEKLGP 281

Query:    80 EEVHKYVGQEPSGRNFNELILDHNSE 105
             + VH YVGQEPSGRNFNEL+LD N +
Sbjct:   282 KVVHSYVGQEPSGRNFNELVLDQNKK 307
GO:0005739 "mitochondrion" evidence=ISS
GO:0004359 "glutaminase activity" evidence=ISS
GO:0006541 "glutamine metabolic process" evidence=ISS
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
UNIPROTKB|F1SN47 GLS "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H7BZD1 GLS "Glutaminase kidney isoform, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LR09 Gls "Glutaminase kidney isoform, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NHM6 GLS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM79 GLS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:95752 Gls "glutaminase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2707 Gls "glutaminase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P13264 Gls "Glutaminase kidney isoform, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RJ93 GLS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8FMX4GLSA_COREF3, ., 5, ., 1, ., 20.53750.76190.1891yesN/A
O94925GLSK_HUMAN3, ., 5, ., 1, ., 20.61900.80.1255yesN/A
Q8NMT3GLSA_CORGL3, ., 5, ., 1, ., 20.53750.76190.1937yesN/A
D3Z7P3GLSK_MOUSE3, ., 5, ., 1, ., 20.63090.80.1246yesN/A
Q19013GLSA_CAEEL3, ., 5, ., 1, ., 20.61250.76190.1322yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.5.1.2LOW CONFIDENCE prediction!
3rd Layer3.5.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
pfam04960 286 pfam04960, Glutaminase, Glutaminase 2e-41
PRK00971 307 PRK00971, PRK00971, glutaminase; Provisional 2e-33
TIGR03814 300 TIGR03814, Gln_ase, glutaminase A 5e-32
COG2066 309 COG2066, GlsA, Glutaminase [Amino acid transport a 5e-31
PRK12356 319 PRK12356, PRK12356, glutaminase; Reviewed 1e-27
PRK12357 326 PRK12357, PRK12357, glutaminase; Reviewed 3e-12
>gnl|CDD|191140 pfam04960, Glutaminase, Glutaminase Back     alignment and domain information 
 Score =  137 bits (347), Expect = 2e-41
 Identities = 40/82 (48%), Positives = 54/82 (65%)

Query: 22  QVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEE 81
           +VADYIP LA+ DP   G++V TVDGQ +S G  + PF++QS SK  T A+AL +L +E 
Sbjct: 2   KVADYIPALAKVDPDLLGIAVVTVDGQVHSAGDADEPFSLQSISKVFTLALALGDLGEEY 61

Query: 82  VHKYVGQEPSGRNFNELILDHN 103
           V   VG+EPSG  FN ++    
Sbjct: 62  VWSRVGKEPSGDPFNSIVQLET 83

This family of enzymes deaminates glutamine to glutamate EC:3.5.1.2. Length = 286
>gnl|CDD|234880 PRK00971, PRK00971, glutaminase; Provisional Back     alignment and domain information
>gnl|CDD|234362 TIGR03814, Gln_ase, glutaminase A Back     alignment and domain information
>gnl|CDD|224977 COG2066, GlsA, Glutaminase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|237073 PRK12356, PRK12356, glutaminase; Reviewed Back     alignment and domain information
>gnl|CDD|237074 PRK12357, PRK12357, glutaminase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
PRK00971 307 glutaminase; Provisional 100.0
COG2066 309 GlsA Glutaminase [Amino acid transport and metabol 100.0
PRK12356 319 glutaminase; Reviewed 100.0
TIGR03814 300 Gln_ase glutaminase A. This family describes the e 100.0
PRK12357 326 glutaminase; Reviewed 100.0
PF04960 286 Glutaminase: Glutaminase; InterPro: IPR015868 Glut 100.0
KOG0506|consensus 622 99.97
PRK15442 284 beta-lactamase TEM; Provisional 94.81
PF02113 444 Peptidase_S13: D-Ala-D-Ala carboxypeptidase 3 (S13 93.33
PRK11113 477 D-alanyl-D-alanine carboxypeptidase/endopeptidase; 90.33
PF00144 329 Beta-lactamase: Beta-lactamase; InterPro: IPR00146 88.22
COG2367 329 PenP Beta-lactamase class A [Defense mechanisms] 83.44
PF06089 324 Asparaginase_II: L-asparaginase II; InterPro: IPR0 83.42
PRK03642 432 putative periplasmic esterase; Provisional 81.9
PF00768 240 Peptidase_S11: D-alanyl-D-alanine carboxypeptidase 80.16
>PRK00971 glutaminase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=7.7e-41  Score=268.22  Aligned_cols=102  Identities=41%  Similarity=0.646  Sum_probs=92.8

Q ss_pred             chhhhhhhhcccccccCCCCccCCcchhhhccCCCCeEEEEEecCCcEEeecCCCcccchhhhhHHHHHHHHHhhcChHH
Q psy8039           2 SSDQCVQSSKFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEE   81 (105)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~G~vA~YIP~La~~dp~~fgiai~tvdG~~~~~GD~~~~FsiQSisK~f~~~lAL~~~G~e~   81 (105)
                      ...+.++...-+......+|+||+|||+||++||++|||||||+||++|++||++++||||||||||+|++||+++|.|+
T Consensus         3 ~~~~~l~~~~~~~~~~~~~G~vA~YIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~FsiQSisK~f~l~lal~~~G~~~   82 (307)
T PRK00971          3 LMQAILEEILEEVRPLIGQGKVADYIPELAKVDPNKLGIAVCTVDGEVYSAGDADERFSIQSISKVFSLALALQHYGEEE   82 (307)
T ss_pred             chHHHHHHHHHHHHHHhCCCCCCcccHHhhCCChhHeEEEEEecCCcEEEecCCCCceechhhHHHHHHHHHHHHhCHHH
Confidence            34556666655555568889999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHhhCCCCCCCCCceee-eccC
Q psy8039          82 VHKYVGQEPSGRNFNELI-LDHN  103 (105)
Q Consensus        82 V~~~VG~EPSG~~FNSi~-le~~  103 (105)
                      ||+|||+||||+|||||+ ||.+
T Consensus        83 V~~~VG~EPSG~~FNSi~~Le~~  105 (307)
T PRK00971         83 VWQRVGKEPSGDPFNSLVQLELE  105 (307)
T ss_pred             HHHHhCCCCCCCCCcchhhhhcc
Confidence            999999999999999996 7753

>COG2066 GlsA Glutaminase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12356 glutaminase; Reviewed Back     alignment and domain information
>TIGR03814 Gln_ase glutaminase A Back     alignment and domain information
>PRK12357 glutaminase; Reviewed Back     alignment and domain information
>PF04960 Glutaminase: Glutaminase; InterPro: IPR015868 Glutaminases (3 Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PRK15442 beta-lactamase TEM; Provisional Back     alignment and domain information
>PF02113 Peptidase_S13: D-Ala-D-Ala carboxypeptidase 3 (S13) family; InterPro: IPR000667 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK11113 D-alanyl-D-alanine carboxypeptidase/endopeptidase; Provisional Back     alignment and domain information
>PF00144 Beta-lactamase: Beta-lactamase; InterPro: IPR001466 This entry represents the serine beta-lactamase-like superfamily Back     alignment and domain information
>COG2367 PenP Beta-lactamase class A [Defense mechanisms] Back     alignment and domain information
>PF06089 Asparaginase_II: L-asparaginase II; InterPro: IPR010349 This family consists of several bacterial L-asparaginase II proteins Back     alignment and domain information
>PRK03642 putative periplasmic esterase; Provisional Back     alignment and domain information
>PF00768 Peptidase_S11: D-alanyl-D-alanine carboxypeptidase This is family S11 in the peptidase classification Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
3ss3_A 479 Crystal Structure Of Mouse Glutaminase C, Ligand-Fr 1e-28
3unw_A 534 Crystal Structure Of Human Gac In Complex With Glut 6e-28
3czd_A 315 Crystal Structure Of Human Glutaminase In Complex W 6e-28
3vp4_A 316 Crystal Structure Of Human Glutaminase In Complex W 6e-28
3if5_A 456 Crystal Structure Analysis Of Mglu Length = 456 6e-15
1u60_A 310 Mcsg Apc5046 Probable Glutaminase Ybas Length = 310 1e-10
2pby_A 308 Probable Glutaminase From Geobacillus Kaustophilus 6e-09
3agf_A 327 Crystal Structure Of Bacillus Glutaminase In The Pr 2e-06
2osu_A 330 Probable Glutaminase From Bacillus Subtilis Complex 6e-06
1mki_A 330 Crystal Structure Of Bacillus Subtilis Probable Glu 2e-05
>pdb|3SS3|A Chain A, Crystal Structure Of Mouse Glutaminase C, Ligand-Free Form Length = 479 Back     alignment and structure 
Iteration: 1

 Score =  121 bits (303), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (78%)
Query: 22  QVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEE 81
           +VADYIPQLA+  P  WGVSVCTVDGQR+SIG T +PF +QSC KPL YAIA+ +L  E 
Sbjct: 126 KVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAIAVNDLGTEY 185
Query: 82  VHKYVGQEPSGRNFNELILDHNSE 105
           VH+YVG+EPSG  FN+L L+ + +
Sbjct: 186 VHRYVGKEPSGLRFNKLFLNEDDK 209
>pdb|3UNW|A Chain A, Crystal Structure Of Human Gac In Complex With Glutamate Length = 534 Back     alignment and structure
>pdb|3CZD|A Chain A, Crystal Structure Of Human Glutaminase In Complex With L-Glutamate Length = 315 Back     alignment and structure
>pdb|3VP4|A Chain A, Crystal Structure Of Human Glutaminase In Complex With Inhibitor 4 Length = 316 Back     alignment and structure
>pdb|3IF5|A Chain A, Crystal Structure Analysis Of Mglu Length = 456 Back     alignment and structure
>pdb|1U60|A Chain A, Mcsg Apc5046 Probable Glutaminase Ybas Length = 310 Back     alignment and structure
>pdb|2PBY|A Chain A, Probable Glutaminase From Geobacillus Kaustophilus Hta426 Length = 308 Back     alignment and structure
>pdb|3AGF|A Chain A, Crystal Structure Of Bacillus Glutaminase In The Presence Of 4.3m Nacl Length = 327 Back     alignment and structure
>pdb|2OSU|A Chain A, Probable Glutaminase From Bacillus Subtilis Complexed With 6-diazo-5-oxo-l-norleucine Length = 330 Back     alignment and structure
>pdb|1MKI|A Chain A, Crystal Structure Of Bacillus Subtilis Probable Glutaminase, Apc1040 Length = 330 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
3agd_A 456 Salt-tolerant glutaminase; glutaminase super famil 2e-34
1u60_A 310 Probable glutaminase YBAS; structural genomics, AP 1e-33
1mki_A 330 Probable glutaminase YBGJ; structural genomics, PS 2e-33
2pby_A 308 Glutaminase; secsg, riken, structural genomics, PS 5e-33
3voy_A 315 Glutaminase kidney isoform, mitochondrial; hydrola 8e-33
3uo9_A 534 Glutaminase kidney isoform, mitochondrial; hydrola 4e-30
>3agd_A Salt-tolerant glutaminase; glutaminase super family, hydrolase; 2.20A {Micrococcus luteus} PDB: 3age_A* 3if5_A 3ih8_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Length = 456 Back     alignment and structure
 Score =  121 bits (305), Expect = 2e-34
 Identities = 38/84 (45%), Positives = 50/84 (59%)

Query: 22  QVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEE 81
           + A YIP LA ADP  +G+++ T  G+ +  G  ++ FTIQS SKP TYA AL +     
Sbjct: 23  ETAQYIPVLAEADPDRFGIALATPTGRLHCAGDADVEFTIQSASKPFTYAAALVDRGFAA 82

Query: 82  VHKYVGQEPSGRNFNELILDHNSE 105
           V + VG  PSG  FNEL L+  S 
Sbjct: 83  VDRQVGLNPSGEAFNELSLEAESH 106
>1u60_A Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiat midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} SCOP: e.3.1.2 Length = 310 Back     alignment and structure
>1mki_A Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} SCOP: e.3.1.2 PDB: 2osu_A* 3brm_A* 3agf_A Length = 330 Back     alignment and structure
>2pby_A Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative, riken structural genomics/proteomics initiative, RSGI; 2.07A {Geobacillus kaustophilus} Length = 308 Back     alignment and structure
>3voy_A Glutaminase kidney isoform, mitochondrial; hydrolase; 2.20A {Homo sapiens} PDB: 3czd_A 3voz_A* 3vp0_A* 3vp1_A* 3vp2_A 3vp3_A 3vp4_A Length = 315 Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Length = 534 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
1u60_A 310 Probable glutaminase YBAS; structural genomics, AP 100.0
2pby_A 308 Glutaminase; secsg, riken, structural genomics, PS 100.0
3voy_A 315 Glutaminase kidney isoform, mitochondrial; hydrola 100.0
1mki_A 330 Probable glutaminase YBGJ; structural genomics, PS 100.0
3agd_A 456 Salt-tolerant glutaminase; glutaminase super famil 100.0
3uo9_A 534 Glutaminase kidney isoform, mitochondrial; hydrola 100.0
3i7j_A 280 Beta-lactamase MB2281C; alpha-beta protein., struc 96.63
3lez_A 260 Beta-lactamase; antibiotic resistance, halotoleran 96.18
4ewf_A 275 Beta-lactamase; ABA-sandwich, structural genomics, 96.15
3qhy_A 271 Beta-lactamase; enyzme-inhibitor complex, beta-pro 95.92
3ny4_A 265 Beta-lactamase, penicillinase; penicillin binding 95.17
4dxb_A 637 RG13, maltose-binding periplasmic protein, beta-la 94.99
1ghp_A 258 Beta-lactamase, penicillinase; hydrolase, antibiot 94.97
4euz_A 283 Carbapenem-hydrolizing beta-lactamase SFC-1; carba 94.82
1n9b_A 265 Penicillinase, beta-lactamase SHV-2; beta-lactam h 94.8
3cjm_A 282 Putative beta-lactamase; NP_815223.1, structural g 94.45
1m40_A 263 TEM-1, beta-lactamase TEM; acylation mechanism, ul 94.3
1hzo_A 271 Beta-lactamase; mixed alpha/beta, cephalosporinase 94.24
1g6a_A 271 Beta-lactamase PSE-4; class A beta-lactamase, carb 94.12
2cc1_A 262 Beta-lactamase, penicillinase; hydrolase, antibiot 94.04
3dw0_A 294 Class A carbapenemase KPC-2; beta-lactamase, antib 93.93
2wk0_A 265 Beta-lactamase; hydrolase, iodopenicillanate, anti 93.84
1bsg_A 266 Beta lactamase, penicillinase; hydrolase, antibiot 93.82
3p09_A 290 Beta-lactamase; structural genomics, center for st 93.76
3c5a_A 264 Class A carbapenemase KPC-2; beta-lactamase, C-ter 93.67
2p74_A 263 Beta-lactamase CTX-M-9A; ultra-high resolution, ac 93.59
1bue_A 265 Protein (imipenem-hydrolysing beta-lactamase); hyd 93.47
1e25_A 282 Extended-spectrum beta-lactamase PER-1; hydrolase, 93.07
1alq_A 266 CP254 beta-lactamase; hydrolase, circular permuted 93.04
1tvf_A 369 PBP4, penicillin binding protein 4; structural gen 92.91
2qpn_A 287 Beta-lactamase GES-1; APO-enzyme, plasmid, hydrola 92.85
1o7e_A 276 L2 beta lactamase; hydrolase, class A; 1.51A {Sten 92.71
2wuq_A 318 BLAB, beta-lactamase regulatory protein BLAB; clas 92.55
3o3v_A 335 Beta-lactamase, CLBP protein; alpha/beta, disulfid 92.4
1w7f_A 307 Beta-lactamase; hydrolase, isocitrate, bacillus li 92.3
2j9o_A 298 TLL2115 protein; penicillin-binding protein, hydro 91.11
1w79_A 489 D-alanyl-D-alanine carboxypeptidase; penicillin-bi 91.03
1w5d_A 462 Penicillin-binding protein; D-Ala-D-Ala-carboxypep 90.25
2bcf_A 276 Probable D-alanyl-D-alanine carboxypeptidase DACB2 90.18
1es5_A 262 DD-transpeptidase; penicillin-binding, serine pept 89.71
2qmi_A 447 PBP related beta-lactamase; PAB87, octamer, LU-HPD 89.63
3tg9_A 356 Penicillin-binding protein; structural genomics, P 89.61
4gdn_A 342 Protein FLP; peptidase, alpha/beta, hydrolase; HET 89.48
3mzf_A 363 D-alanyl-D-alanine carboxypeptidase DACA; beta-lac 89.33
3a3j_A 344 PBP5; penicillin binding protein 5, DACA, hydrolas 88.09
2xep_A 458 ORF12; hydrolase; 1.50A {Streptomyces clavuligerus 87.98
3a3d_A 453 PBP4, penicillin-binding protein 4; DACB, hydrolas 87.95
4hes_A 275 Beta-lactamase class A-like protein; structural ge 87.56
2iwb_A 246 Methicillin resistance MECR1 protein; antibiotic r 87.45
3hlc_A 432 Transesterase, LOVD; alpha/beta hydrolase fold, tr 87.21
1ci9_A 392 ESTB, protein (carboxylesterase); hydrolase, cabox 87.03
2ffy_A 358 Beta-lactamase; AMPC, deacylation, transition stat 86.89
1zkj_A 359 CMY-10, extended-spectrum beta-lactamase; plasmid, 86.74
2drw_A 363 DAA, D-amino acid amidase; penicillin recognizing 86.46
3v39_A 418 D-alanyl-D-alanine carboxypeptidase; peptidoglycan 86.37
2wzx_A 371 Beta-lactamase; inhibitor, hydrolase, antibiotic r 86.36
1yqs_A 349 D-alanyl-D-alanine carboxypeptidase; cell well bio 86.29
2ex2_A 458 Penicillin-binding protein 4; cephem, penem, D-Ala 86.18
1xp4_A 379 D-alanyl-D-alanine carboxypeptidase; five-stranded 86.0
2dcf_A 392 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1. 85.72
2x02_A 248 Beta-lactamase OXA-10; class D, hydrolase, antibio 85.72
1xkz_A 255 Regulatory protein BLAR1; beta-lactam receptor, si 85.67
2qz6_A 358 Beta-lactamase; psychrophIle, cold adaptation, ant 85.36
3ita_A 352 D-alanyl-D-alanine carboxypeptidase DACC; ppenicil 84.92
3hun_A 453 Penicillin-binding protein 4; ampicillin, beta-lac 83.18
3rju_A 351 Beta-lactamase/D-alanine carboxypeptidase; structu 82.93
1nrf_A 262 Regulatory protein BLAR1; penicillin-receptor, bet 82.59
1ei5_A 520 D-aminopeptidase, DAP; penicillin binding protein, 81.66
>1u60_A Probable glutaminase YBAS; structural genomics, APC5046, PSI, protein structure initiat midwest center for structural genomics, MCSG; 1.61A {Escherichia coli} SCOP: e.3.1.2 Back     alignment and structure
Probab=100.00  E-value=3e-41  Score=269.73  Aligned_cols=92  Identities=36%  Similarity=0.550  Sum_probs=87.4

Q ss_pred             cccccccCCCCccCCcchhhhccCCCCeEEEEEecCCcEEeecCCCcccchhhhhHHHHHHHHHhhcChHHHHHhhCCCC
Q psy8039          11 KFSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEP   90 (105)
Q Consensus        11 ~~~~~~~~~~G~vA~YIP~La~~dp~~fgiai~tvdG~~~~~GD~~~~FsiQSisK~f~~~lAL~~~G~e~V~~~VG~EP   90 (105)
                      .+++.+...+|+||+|||+||++||++|||||||+||++|++||++++||||||||||+|++||+++|.|+||+|||+||
T Consensus        14 ~~~~~~~~~~G~vA~YIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~FsiQSISK~f~l~lAl~~~G~e~V~~~VG~EP   93 (310)
T 1u60_A           14 AYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADP   93 (310)
T ss_dssp             HHHHHTTCCCCBCCCSSHHHHTSCTTCCEEEEEETTSCEEEEESTTCCEECGGGHHHHHHHHHHHHHCHHHHHHHTCSCC
T ss_pred             HHHhcccCCCCccccccHHhhcCChhHeEEEEEeCCCCEEecCCCCCceehHHHHHHHHHHHHHHHHCHHHHHHHhCCCC
Confidence            35566677789999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCceee-ecc
Q psy8039          91 SGRNFNELI-LDH  102 (105)
Q Consensus        91 SG~~FNSi~-le~  102 (105)
                      ||+|||||+ ||.
T Consensus        94 SG~~FNSi~~Le~  106 (310)
T 1u60_A           94 TGLPFNSVIALEL  106 (310)
T ss_dssp             CSSCTTCHHHHHH
T ss_pred             CCCCCcchhhhhc
Confidence            999999998 884
>2pby_A Glutaminase; secsg, riken, structural genomics, PSI, protein structure initiative, riken structural genomics/proteomics initiative, RSGI; 2.07A {Geobacillus kaustophilus} Back     alignment and structure
>3voy_A Glutaminase kidney isoform, mitochondrial; hydrolase; 2.20A {Homo sapiens} PDB: 3czd_A 3voz_A* 3vp0_A* 3vp1_A* 3vp2_A 3vp3_A 3vp4_A Back     alignment and structure
>1mki_A Probable glutaminase YBGJ; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; HET: SEP; 2.00A {Bacillus subtilis} SCOP: e.3.1.2 PDB: 2osu_A* 3brm_A* 3agf_A Back     alignment and structure
>3agd_A Salt-tolerant glutaminase; glutaminase super family, hydrolase; 2.20A {Micrococcus luteus} PDB: 3age_A* 3if5_A 3ih8_A 3ih9_A 3iha_A* 3ihb_A 2dfw_A Back     alignment and structure
>3uo9_A Glutaminase kidney isoform, mitochondrial; hydrolase-hydrolase inhibitor complex; HET: 04A; 2.30A {Homo sapiens} PDB: 3unw_A* 3ss3_A 3ss4_A 3ss5_A* Back     alignment and structure
>3i7j_A Beta-lactamase MB2281C; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 2.20A {Mycobacterium bovis} Back     alignment and structure
>3lez_A Beta-lactamase; antibiotic resistance, halotolerant, DEEP- SEA bacterium, hydrolase; HET: EPE; 1.25A {Oceanobacillus iheyensis} SCOP: e.3.1.1 Back     alignment and structure
>4ewf_A Beta-lactamase; ABA-sandwich, structural genomics, midwest center for struct genomics (MCSG), PSI-biology, cytoplasmic, hydrolase; 2.00A {Sphaerobacter thermophilus} Back     alignment and structure
>3qhy_A Beta-lactamase; enyzme-inhibitor complex, beta-propeller, protein:protein interaction; 2.06A {Bacillus anthracis} Back     alignment and structure
>3ny4_A Beta-lactamase, penicillinase; penicillin binding protein, beta-lactam complex, hydrolase-A complex; HET: SMX; 1.22A {Mycobacterium tuberculosis} PDB: 3m6b_A* 3dwz_A* 3iqa_A* 3cg5_A* 3m6h_A* 4df6_A* 2gdn_A 3vfh_A* 3vff_A* 3n8l_A* 3n6i_A* 3n7w_A* 3n8r_A* 3n8s_A* 3nbl_A* 3nc8_A* 3nck_A* 3nde_A* 3ndg_A* Back     alignment and structure
>4dxb_A RG13, maltose-binding periplasmic protein, beta-lactama chimera; TEM, beta-lactamase, MBP, allosteric regulation, zinc bindin maltose binding; 2.29A {Escherichia coli} PDB: 4dxc_A Back     alignment and structure
>1ghp_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, beta-lactam hydrolysis, benzylpenicillin, cephaloridine; HET: PNM; 1.76A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1ghi_A* 1ghm_A* 1kgf_A 1kge_A 1ome_A 1kgg_A 1dja_A 3blm_A 1blh_A* 1blc_A 1djc_A 1djb_A 1blp_A 1pio_A Back     alignment and structure
>4euz_A Carbapenem-hydrolizing beta-lactamase SFC-1; carbapenemase, hydrolase, antibiotic resistance, beta-lactam complex; HET: HAR MEM; 1.08A {Serratia fonticola} PDB: 4eqi_A 4ev4_A* Back     alignment and structure
>1n9b_A Penicillinase, beta-lactamase SHV-2; beta-lactam hydrolase, detergent binding, drug design, radiation damage; HET: MA4 EPE; 0.90A {Klebsiella pneumoniae} SCOP: e.3.1.1 PDB: 3d4f_A* 2zd8_A* 1q2p_A* 1shv_A* 1vm1_A* 2g2u_A 2h5s_A* 1ong_A* 3c4o_A 3c4p_A 3mke_A* 3mkf_A* 3mxr_A* 3mxs_A* 3n4i_A 2a3u_A* 3opr_A* 3opl_A* 3oph_A* 3opp_A* ... Back     alignment and structure
>3cjm_A Putative beta-lactamase; NP_815223.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; HET: MSE; 1.50A {Enterococcus faecalis} Back     alignment and structure
>1m40_A TEM-1, beta-lactamase TEM; acylation mechanism, ultra- high resolution, hydrolase; HET: CB4; 0.85A {Escherichia coli} SCOP: e.3.1.1 PDB: 1jwp_A* 1nxy_A* 1ny0_A* 1nym_A* 1nyy_A* 1pzo_A* 1erm_A* 1ero_A* 1erq_A* 1s0w_A 1xpb_A 1li0_A 1htz_A 1jtd_A 1esu_A 1jwz_A* 1li9_A 1jwv_A* 1jtg_A 1axb_A* ... Back     alignment and structure
>1hzo_A Beta-lactamase; mixed alpha/beta, cephalosporinase, hydrolase; HET: MES; 1.75A {Proteus vulgaris} SCOP: e.3.1.1 Back     alignment and structure
>1g6a_A Beta-lactamase PSE-4; class A beta-lactamase, carbenicillinase, R234K mutant, hydrolase; 1.75A {Pseudomonas aeruginosa} SCOP: e.3.1.1 PDB: 1g68_A Back     alignment and structure
>2cc1_A Beta-lactamase, penicillinase; hydrolase, antibiotic resistance, broad-spectrum; 2.13A {Mycobacterium fortuitum} SCOP: e.3.1.1 Back     alignment and structure
>3dw0_A Class A carbapenemase KPC-2; beta-lactamase, antibiotic resistance, hydrolase; 1.60A {Escherichia coli} Back     alignment and structure
>2wk0_A Beta-lactamase; hydrolase, iodopenicillanate, antibiotic resistance; HET: BIY CIT; 1.65A {Bacillus licheniformis} PDB: 2x71_A* 3b3x_A* 1i2s_A* 1i2w_A* 2y91_A* 2blm_A 4blm_A 3sh9_A* 3sh7_A* 3sh8_A* 3ly3_A 3kgo_A* 3ly4_A* 3kgm_A* 3kgn_A* 3m2j_A* 3m2k_A* 3soi_A* 1mbl_A Back     alignment and structure
>1bsg_A Beta lactamase, penicillinase; hydrolase, antibiotic resistance; 1.85A {Streptomyces albus} SCOP: e.3.1.1 Back     alignment and structure
>3p09_A Beta-lactamase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich, cytosol; HET: MSE; 1.90A {Francisella tularensis subsp} Back     alignment and structure
>3c5a_A Class A carbapenemase KPC-2; beta-lactamase, C-terminal deleted mutant, plasmid, hydrolase; HET: CIT; 1.23A {Escherichia coli} PDB: 3rxw_A* 3rxx_A* 2ods_A 2ov5_A* 3e2k_A 3e2l_A* Back     alignment and structure
>2p74_A Beta-lactamase CTX-M-9A; ultra-high resolution, acylation, ESBL, hydrolase; HET: PO4; 0.88A {Escherichia coli} PDB: 3g2y_A* 4dds_A* 4ddy_A* 4de0_A* 4de1_A* 4de2_A* 4de3_A* 1ylj_A* 1yly_A* 1ym1_A* 1yms_A* 1ymx_A* 3g2z_A* 3g30_A* 3g31_A* 3g32_A* 3g34_A* 3g35_A* 1ylt_A* 1ylz_A* ... Back     alignment and structure
>1bue_A Protein (imipenem-hydrolysing beta-lactamase); hydrolase, antibiotic resistance, class A carbapenemase; 1.64A {Enterobacter cloacae} SCOP: e.3.1.1 PDB: 1bul_A* 1dy6_A Back     alignment and structure
>1e25_A Extended-spectrum beta-lactamase PER-1; hydrolase, antibiotic resistance, class A cephalosporinase; 1.9A {Pseudomonas aeruginosa} SCOP: e.3.1.1 Back     alignment and structure
>1alq_A CP254 beta-lactamase; hydrolase, circular permuted, antibiotic resistance; 1.80A {Staphylococcus aureus} SCOP: e.3.1.1 Back     alignment and structure
>1tvf_A PBP4, penicillin binding protein 4; structural genomics, nysgxrc target, SAV0642, PSI, protein structure initiative; 2.00A {Staphylococcus aureus} SCOP: b.105.1.2 e.3.1.1 Back     alignment and structure
>2qpn_A Beta-lactamase GES-1; APO-enzyme, plasmid, hydrolase; 1.10A {Klebsiella pneumoniae} PDB: 3nia_A* 3ni9_A* Back     alignment and structure
>1o7e_A L2 beta lactamase; hydrolase, class A; 1.51A {Stenotrophomonas maltophilia} SCOP: e.3.1.1 PDB: 1n4o_A Back     alignment and structure
>2wuq_A BLAB, beta-lactamase regulatory protein BLAB; class A beta-lactamase fold, transcription regulation, beta-lactamase induction, transcription; 1.80A {Streptomyces cacaoi} Back     alignment and structure
>3o3v_A Beta-lactamase, CLBP protein; alpha/beta, disulfide bridge, hydrolase; 2.40A {Escherichia coli} Back     alignment and structure
>1w7f_A Beta-lactamase; hydrolase, isocitrate, bacillus licheniformis hydrolase; HET: ICT; 1.80A {Bacillus licheniformis} Back     alignment and structure
>2j9o_A TLL2115 protein; penicillin-binding protein, hydrolase, lactamase, thioestera DD-peptidase; 1.50A {Synechococcus elongatus} PDB: 2jbf_A* 2j7v_A 2j8y_A* Back     alignment and structure
>1w79_A D-alanyl-D-alanine carboxypeptidase; penicillin-binding, peptidoglycan, transpeptidase, antibiotic resistance, hydrolase; 1.8A {Actinomadura SP} SCOP: e.3.1.3 PDB: 1w8q_A 1w8y_A* 2vgj_A* 2vgk_A* 2xln_A* 2y5o_A* 2xdm_A* 2xk1_A* 2y4a_A* 2y55_A* 2y59_A* 2wke_A* 2y5r_A* 3zvt_A* 3zvw_A* Back     alignment and structure
>1w5d_A Penicillin-binding protein; D-Ala-D-Ala-carboxypeptidase, peptidoglycan, beta-lactam, hydrolase, peptidoglycan synthesis; 2.1A {Bacillus subtilis} SCOP: e.3.1.3 PDB: 2j9p_A* Back     alignment and structure
>2bcf_A Probable D-alanyl-D-alanine carboxypeptidase DACB2; penicillin-binding protein, DD-2 carboxypeptidase, directed evolution; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1es5_A DD-transpeptidase; penicillin-binding, serine peptidase, BET lactamase, hydrolase carboxypeptidase, hydrolase; 1.40A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1skf_A 1es2_A 1j9m_A 1esi_A 1es3_A 1es4_A Back     alignment and structure
>2qmi_A PBP related beta-lactamase; PAB87, octamer, LU-HPDO3A, archaea, hydrolase; HET: DO3; 2.20A {Pyrococcus abyssi} Back     alignment and structure
>3tg9_A Penicillin-binding protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.20A {Bacillus halodurans} Back     alignment and structure
>4gdn_A Protein FLP; peptidase, alpha/beta, hydrolase; HET: PE4; 3.20A {Staphylococcus aureus} Back     alignment and structure
>3mzf_A D-alanyl-D-alanine carboxypeptidase DACA; beta-lactam antibiotic, penicillin-binding protein, DD- carboxypeptidase, hydrolase; HET: IM2; 1.50A {Escherichia coli} PDB: 1nzu_A 1nzo_A* 3beb_A* 3bec_A* 3mzd_A* 3mze_A* 1z6f_A* 1nj4_A 1hd8_A 1sdn_A 4drt_A Back     alignment and structure
>3a3j_A PBP5; penicillin binding protein 5, DACA, hydrolase; 2.15A {Haemophilus influenzae} Back     alignment and structure
>2xep_A ORF12; hydrolase; 1.50A {Streptomyces clavuligerus} PDB: 2xf3_A* 2xfs_A* 2xft_A 2xgn_A 2xh9_A* Back     alignment and structure
>3a3d_A PBP4, penicillin-binding protein 4; DACB, hydrolase; 1.60A {Haemophilus influenzae} PDB: 3a3e_A* 3a3f_A* 3a3i_A* Back     alignment and structure
>4hes_A Beta-lactamase class A-like protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, COG COG2367, H; HET: MSE; 1.90A {Veillonella parvula} Back     alignment and structure
>2iwb_A Methicillin resistance MECR1 protein; antibiotic resistance, bacterial antibiotic resistance, methicillin resistance, beta-lactamic antibiotics, MRSA; 1.8A {Staphylococcus aureus} PDB: 2iwc_A* 2iwd_A* Back     alignment and structure
>3hlc_A Transesterase, LOVD; alpha/beta hydrolase fold, transferase; HET: PG4; 2.00A {Aspergillus terreus} PDB: 3hld_A* 3hlf_A* 3hle_A* 3hlg_A* 3hlb_A 3hl9_A Back     alignment and structure
>1ci9_A ESTB, protein (carboxylesterase); hydrolase, caboxylesterase; HET: DFP; 1.80A {Burkholderia gladioli} SCOP: e.3.1.1 PDB: 1ci8_A* Back     alignment and structure
>2ffy_A Beta-lactamase; AMPC, deacylation, transition state, boronic acid, hydrolase; HET: SM3; 1.07A {Escherichia coli} SCOP: e.3.1.1 PDB: 1pi5_A* 1pi4_A* 2hds_A* 1c3b_A* 1fco_A* 1ga9_A* 1iem_A* 1kds_A* 1kdw_A* 1ke0_A* 1ke3_A* 1iel_A 1kvm_A* 1l2s_A* 1ll5_A* 1ll9_A* 1llb_A* 1mxo_A* 1my8_A* 1xgi_A* ... Back     alignment and structure
>1zkj_A CMY-10, extended-spectrum beta-lactamase; plasmid, class C, hydrolase; 1.55A {Enterobacter aerogenes} Back     alignment and structure
>2drw_A DAA, D-amino acid amidase; penicillin recognizing protein, D-stereospecific, hydrophobic, hydrolase; 2.10A {Ochrobactrum anthropi} SCOP: e.3.1.1 PDB: 2dns_A 2efu_A* 2efx_A* Back     alignment and structure
>3v39_A D-alanyl-D-alanine carboxypeptidase; peptidoglycan transpeptidase fold, endopeptidase, serine MOD hepes buffer molecule, hydrolase; HET: PGE; 1.45A {Bdellovibrio bacteriovorus} Back     alignment and structure
>2wzx_A Beta-lactamase; inhibitor, hydrolase, antibiotic resistance; HET: ZX0; 1.40A {Pseudomonas aeruginosa} PDB: 2wzz_A* 3s1y_A* 3s22_A* Back     alignment and structure
>1yqs_A D-alanyl-D-alanine carboxypeptidase; cell well biosynthesis, beta-lactam, beta-sultam, sulfonylation, hydrolase; HET: BSA; 1.05A {Streptomyces SP} SCOP: e.3.1.1 PDB: 1cef_A* 1ceg_A* 1ikg_A* 1iki_A* 1hvb_A* 1pw1_A* 1pw8_A* 1mpl_A* 1pwd_A* 1pwc_A* 1scw_A* 1pwg_A* 3pte_A 1sde_A* Back     alignment and structure
>2ex2_A Penicillin-binding protein 4; cephem, penem, D-Ala alanine-carboxypeptidase, D-alanyl-D-alanine-endopeptidase, hydrolase; 1.55A {Escherichia coli} SCOP: e.3.1.3 PDB: 2ex6_A* 2ex8_A* 2ex9_A* 2exa_A* 2exb_A* Back     alignment and structure
>1xp4_A D-alanyl-D-alanine carboxypeptidase; five-stranded antiparallel beta-sheet, omega-like loop, hydrolase; 2.80A {Streptococcus pneumoniae R6} SCOP: b.105.1.1 e.3.1.1 Back     alignment and structure
>2dcf_A 6-aminohexanoate-dimer hydrolase; HET: ACA MES; 1.40A {Flavobacterium SP} SCOP: e.3.1.1 PDB: 3a65_A* 1wyc_A 2zm7_A* 2e8i_A* 2zma_A* 3a66_A* 2zm0_A* 1wyb_A 2zm8_A* 2zly_A* 2zm9_A* 2zm2_A* Back     alignment and structure
>2x02_A Beta-lactamase OXA-10; class D, hydrolase, antibiotic resistance; HET: KCX PG4; 1.35A {Pseudomonas aeruginosa} PDB: 1k4e_A* 1k6r_A* 1k6s_A* 1k4f_A* 2x01_A* 2wgv_A* 2wgw_A* 2wkh_A* 2wki_A 2rl3_A* 2hpb_A 2hp9_A 2hp6_A 2wgi_A* 2hp5_A 1fof_A 1k55_A* 1e4d_A* 1ewz_A 1k54_A* ... Back     alignment and structure
>1xkz_A Regulatory protein BLAR1; beta-lactam receptor, signal transduction, signaling protein; HET: CAZ EPE; 1.75A {Staphylococcus aureus} SCOP: e.3.1.1 PDB: 1xa1_A* 1xa7_A* 3q7z_A* 3q7v_A* 3q81_A* 3q82_A* 3uy6_A Back     alignment and structure
>2qz6_A Beta-lactamase; psychrophIle, cold adaptation, antibiotic resistance, hydrolase, periplasm; 2.26A {Pseudomonas fluorescens} Back     alignment and structure
>3ita_A D-alanyl-D-alanine carboxypeptidase DACC; ppenicillin-binding protein, BP6, DD-carboxypeptidase, peptidoglycan, ampicillin, acyl-enzyme complex; HET: AIX AIC; 1.80A {Escherichia coli} PDB: 3it9_A* 3itb_A* Back     alignment and structure
>3hun_A Penicillin-binding protein 4; ampicillin, beta-lactamase, serine type D-Ala, D-Ala-carboxypeptidase, antibiotics; HET: ZZ7; 2.00A {Staphylococcus aureus} PDB: 3hum_A* Back     alignment and structure
>3rju_A Beta-lactamase/D-alanine carboxypeptidase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta sandwich; HET: MSE CIT; 1.50A {Yersinia pestis} PDB: 3ozh_A* Back     alignment and structure
>1nrf_A Regulatory protein BLAR1; penicillin-receptor, beta-lactamase induction, penicillin-binding protein, membrane protein; 2.50A {Bacillus licheniformis} SCOP: e.3.1.1 Back     alignment and structure
>1ei5_A D-aminopeptidase, DAP; penicillin binding protein, alpha/beta domain, beta barrel domain, hydrolase; 1.90A {Ochrobactrum anthropi} SCOP: b.61.3.1 b.61.3.1 e.3.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 105
d1u60a_ 309 e.3.1.2 (A:) Probable glutaminase YbaS {Escherichi 2e-39
d1mkia_ 328 e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus s 2e-38
>d1u60a_ e.3.1.2 (A:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]} Length = 309 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: Glutaminase
domain: Probable glutaminase YbaS
species: Escherichia coli [TaxId: 562]

 Score =  130 bits (329), Expect = 2e-39
 Identities = 31/83 (37%), Positives = 46/83 (55%)

Query: 22  QVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEE 81
           Q ADYIP LA    +   V++ T DG  YS G ++  F ++S SK  T A+ALE++  + 
Sbjct: 24  QNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQA 83

Query: 82  VHKYVGQEPSGRNFNELILDHNS 104
           V   +G +P+G  FN +I     
Sbjct: 84  VQDKIGADPTGLPFNSVIALELH 106
>d1mkia_ e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus subtilis [TaxId: 1423]} Length = 328 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1u60a_ 309 Probable glutaminase YbaS {Escherichia coli [TaxId 100.0
d1mkia_ 328 Probable glutaminase YbgJ {Bacillus subtilis [TaxI 100.0
d1i2sa_ 255 beta-Lactamase, class A {Bacillus licheniformis [T 96.61
d1o7ea_ 267 beta-Lactamase, class A {Stenotrophomonas maltophi 96.52
d1djaa_ 258 beta-Lactamase, class A {Staphylococcus aureus [Ta 95.99
d1iysa_ 261 beta-Lactamase, class A {Escherichia coli, TOHO-1 95.74
d1buea_ 265 beta-Lactamase, class A {Enterobacter cloacae, NMC 95.47
d1m40a_ 263 beta-Lactamase, class A {Escherichia coli, TEM-1 [ 95.1
d2cc1a1 262 beta-Lactamase, class A {Mycobacterium fortuitum [ 94.65
d1e25a_ 278 beta-Lactamase, class A {Pseudomonas aeruginosa, P 94.58
d1w79a1 467 D-alanyl-D-alanine carboxypeptidase Dac {Actinomad 94.46
d1bsga_ 266 beta-Lactamase, class A {Streptomyces albus G [Tax 94.14
d1g6aa_ 266 beta-Lactamase, class A {Pseudomonas aeruginosa, P 94.1
d1n9ba_ 265 beta-Lactamase, class A {Klebsiella pneumoniae, SH 93.91
d1w5da1 458 Penicillin-binding protein DacC {Bacillus subtilis 93.29
d2ex2a1 456 DD-carboxypeptidase DacB {Escherichia coli [TaxId: 90.49
d1es5a_ 260 D-ala carboxypeptidase/transpeptidase {Streptomyce 88.81
d1ei5a3 333 D-aminopeptidase, N-terminal domain {Ochrobactrum 88.07
d1yqsa1 345 D-ala carboxypeptidase/transpeptidase {Streptomyce 86.49
d1onha_ 363 AMPC beta-Lactamase, class C {Enterobacter cloacae 85.91
d2drwa1 362 D-Amino acid amidase DaaA {Ochrobactrum anthropi [ 84.73
d1tvfa2 301 Pencillin binding protein 4 (PbpD), N-terminal dom 84.07
d2hdsa1 358 AMPC beta-Lactamase, class C {Escherichia coli, ce 84.01
d3beca2 259 Penicillin-binding protein 5, N-terminal domain {E 81.33
d1ci9a_ 377 Esterase EstB {Burkholderia gladioli [TaxId: 28095 80.85
>d1u60a_ e.3.1.2 (A:) Probable glutaminase YbaS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: beta-lactamase/transpeptidase-like
superfamily: beta-lactamase/transpeptidase-like
family: Glutaminase
domain: Probable glutaminase YbaS
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=1.1e-40  Score=264.49  Aligned_cols=91  Identities=36%  Similarity=0.557  Sum_probs=86.2

Q ss_pred             ccccccCCCCccCCcchhhhccCCCCeEEEEEecCCcEEeecCCCcccchhhhhHHHHHHHHHhhcChHHHHHhhCCCCC
Q psy8039          12 FSNKVQLFLRQVADYIPQLARADPKYWGVSVCTVDGQRYSIGKTNIPFTIQSCSKPLTYAIALEELDQEEVHKYVGQEPS   91 (105)
Q Consensus        12 ~~~~~~~~~G~vA~YIP~La~~dp~~fgiai~tvdG~~~~~GD~~~~FsiQSisK~f~~~lAL~~~G~e~V~~~VG~EPS   91 (105)
                      +++.+...+||||+|||+||++||++|||||||+||++|++||++++||||||||||+|++||+++|.|.||+|||+|||
T Consensus        14 ~~~~~~~~~GkvA~YIP~La~vdp~~fgiai~t~dG~~~~~GD~~~~F~iqSisK~f~~~lal~~~G~~~v~~~VG~EPS   93 (309)
T d1u60a_          14 YTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPT   93 (309)
T ss_dssp             HHHHTTCCCCBCCCSSHHHHTSCTTCCEEEEEETTSCEEEEESTTCCEECGGGHHHHHHHHHHHHHCHHHHHHHTCSCCC
T ss_pred             HHHhccCCCCCCCCccHHhcCCChHHeEEEEEeCCCcEEecCCcCCcccHHHHHHHHHHHHHHHhHCHHHHHHHhCcCCC
Confidence            44556678899999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceee-ecc
Q psy8039          92 GRNFNELI-LDH  102 (105)
Q Consensus        92 G~~FNSi~-le~  102 (105)
                      |++||||. ||.
T Consensus        94 g~~FNsl~~le~  105 (309)
T d1u60a_          94 GLPFNSVIALEL  105 (309)
T ss_dssp             SSCTTCHHHHHH
T ss_pred             CCCcchhhhhcc
Confidence            99999998 764
>d1mkia_ e.3.1.2 (A:) Probable glutaminase YbgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i2sa_ e.3.1.1 (A:) beta-Lactamase, class A {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1o7ea_ e.3.1.1 (A:) beta-Lactamase, class A {Stenotrophomonas maltophilia, L2 [TaxId: 40324]} Back     information, alignment and structure
>d1djaa_ e.3.1.1 (A:) beta-Lactamase, class A {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1iysa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]} Back     information, alignment and structure
>d1buea_ e.3.1.1 (A:) beta-Lactamase, class A {Enterobacter cloacae, NMC-A carbapenemase [TaxId: 550]} Back     information, alignment and structure
>d1m40a_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TEM-1 [TaxId: 562]} Back     information, alignment and structure
>d2cc1a1 e.3.1.1 (A:27-293) beta-Lactamase, class A {Mycobacterium fortuitum [TaxId: 1766]} Back     information, alignment and structure
>d1e25a_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PER-1 [TaxId: 287]} Back     information, alignment and structure
>d1w79a1 e.3.1.3 (A:1-467) D-alanyl-D-alanine carboxypeptidase Dac {Actinomadura sp. [TaxId: 1989]} Back     information, alignment and structure
>d1bsga_ e.3.1.1 (A:) beta-Lactamase, class A {Streptomyces albus G [TaxId: 1962]} Back     information, alignment and structure
>d1g6aa_ e.3.1.1 (A:) beta-Lactamase, class A {Pseudomonas aeruginosa, PSE-4 carbenicillinase [TaxId: 287]} Back     information, alignment and structure
>d1n9ba_ e.3.1.1 (A:) beta-Lactamase, class A {Klebsiella pneumoniae, SHV-2 [TaxId: 573]} Back     information, alignment and structure
>d1w5da1 e.3.1.3 (A:5-462) Penicillin-binding protein DacC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2ex2a1 e.3.1.3 (A:22-477) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1es5a_ e.3.1.1 (A:) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., K15 [TaxId: 1931]} Back     information, alignment and structure
>d1ei5a3 e.3.1.1 (A:3-335) D-aminopeptidase, N-terminal domain {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1yqsa1 e.3.1.1 (A:3-347) D-ala carboxypeptidase/transpeptidase {Streptomyces sp., R61 [TaxId: 1931]} Back     information, alignment and structure
>d1onha_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Enterobacter cloacae, P99, cephalosporinase [TaxId: 550]} Back     information, alignment and structure
>d2drwa1 e.3.1.1 (A:2-363) D-Amino acid amidase DaaA {Ochrobactrum anthropi [TaxId: 529]} Back     information, alignment and structure
>d1tvfa2 e.3.1.1 (A:15-315) Pencillin binding protein 4 (PbpD), N-terminal domain {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2hdsa1 e.3.1.1 (A:4-361) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]} Back     information, alignment and structure
>d3beca2 e.3.1.1 (A:4-262) Penicillin-binding protein 5, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ci9a_ e.3.1.1 (A:) Esterase EstB {Burkholderia gladioli [TaxId: 28095]} Back     information, alignment and structure