Diaphorina citri psyllid: psy8040

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270--

MDPNNVKDIPMEVDDFQSSGLSAQFSAELDRVALAIAIRGLEEEMGSHITFELHLRDQSATNYCLSDYSQYPVVFFLSHRYKSSSGGCGVSSSRCTASGVELRELRRHNYKSCVFPNKTSASYQDHRHHRTRSGRGMSMGQKISNGVKTVNRESSAPFKPVIPRELAHQRPGRLDIILDMPPASRETQVKHAWNPEDRSLNIFVKDDDKLTFHRHPVAQSTDCIRGRVGFTKGFHIWEVHWSARQRGTHAVVGVGTIDAPLHSVGYQIIRFQ

ccccccccccccccccccccccccccccHHHHHHHHHHHcHHHHHcccEEEEEECcccccccccccccccccEEEEEEcCECccccccccccccccccccccHHcccccccccccccccccccccccccccccccccccCEEECccEEEECccccccccccccccccccccccHHHHccccccccccccccccccccccccEEEcccccEEEEEccccccccccccccccccccEEEEEEEcccccccEEEEEEEcccccccccccEEcccc

*****VK*IPMEVDDFQSSGLSAQFSAELDRVALAIAIRGLEEEMGSHITFELHLRDQSATNYCLSDYSQYPVVFFLSHR*****************SGVELRELRRHNYKSCVFP***********************************************************IILDMPPASRETQVKHAWNPEDRSLNIFVKDDDKLTFHRHPVAQSTDCIRGRVGFTKGFHIWEVHWSARQRGTHAVVGVGTIDAPLHSVGYQIIRFQ

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
SPRY domain-containing SOCS box protein 1	Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	confident	Q5E9X6
SPRY domain-containing SOCS box protein 1	Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	confident	Q96BD6
SPRY domain-containing SOCS box protein 1	Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.	confident	Q9D5L7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046843 [BP]	dorsal appendage formation	probable	GO:0048610, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0007292, GO:0007304, GO:0007306, GO:0009653, GO:0044699, GO:0007276, GO:0000003, GO:0030703, GO:0030707, GO:0016043, GO:0032989, GO:0071840, GO:0048477, GO:0048646, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0044702, GO:0003006, GO:0048856, GO:0048869, GO:0044763
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0007314 [BP]	oocyte anterior/posterior axis specification	probable	GO:0048610, GO:0009994, GO:0030154, GO:0048468, GO:0007569, GO:0007292, GO:0009790, GO:0008358, GO:0000578, GO:0007309, GO:0007308, GO:0009798, GO:0035282, GO:0010259, GO:0007275, GO:0044699, GO:0048609, GO:0007389, GO:0008595, GO:0000003, GO:0009948, GO:0048869, GO:0007276, GO:0048477, GO:0032502, GO:0048599, GO:0032501, GO:0009880, GO:0032504, GO:0009987, GO:0019953, GO:0007281, GO:0022414, GO:0008150, GO:0003002, GO:0022412, GO:0007351, GO:0007350, GO:0044767, GO:0044702, GO:0009952, GO:0044707, GO:0003006, GO:0048856, GO:0044763

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JK9, chain A
Confidence level:very confident
Coverage over the Query: 169-270
View the alignment between query and template
View the model in PyMOL