Diaphorina citri psyllid: psy8050

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
KKKKKKKKKKKKKKKKKRKKKGILANSSSKEKIQDRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKLPLSS
ccccccccccccccccccHHHHHHHHcccccccCECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccHcccccccHHHccccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHccccccccccccccccccccccccccccccccccccc
**********************************DRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKL*L**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKKKKKKKKKKKKKKKKRKKKGILANSSSKEKIQDRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKLPLSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc finger and SCAN domain-containing protein 22 May be involved in transcriptional regulation.confidentP10073
Protein glass Transcription factor required for gene expression specific to photoreceptor cells.confidentQ24732
Transcription factor che-1 Transcription factor essential for the identity of ASE chemosensory neurons. Acts by activating expression of genes that are specific for ASE chemosensory neurons, such as seven-transmembrane receptors or guanylate cyclase. Also required to control the left/right asymmetry in ASE chemosensory neurons by regulating expression of genes such as cog-1 and ceh-36.confidentQ966L8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityconfidentGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0035271 [BP]ring gland developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0035270, GO:0048513, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0001752 [BP]compound eye photoreceptor fate commitmentprobableGO:0046552, GO:0048749, GO:0044707, GO:0030154, GO:0009653, GO:0042706, GO:0044699, GO:0001745, GO:0048869, GO:0007275, GO:0048513, GO:0032502, GO:0009887, GO:0032501, GO:0048663, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0048699, GO:0045165, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150
GO:0043153 [BP]entrainment of circadian clock by photoperiodprobableGO:0009628, GO:0009605, GO:0009314, GO:0050896, GO:0042752, GO:0065007, GO:0009416, GO:0009649, GO:0009648, GO:0008150, GO:0050789
GO:0007605 [BP]sensory perception of soundprobableGO:0032501, GO:0044707, GO:0050954, GO:0007600, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0010114 [BP]response to red lightprobableGO:0009628, GO:0009639, GO:0009314, GO:0050896, GO:0008150, GO:0009416
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0042035 [BP]regulation of cytokine biosynthetic processprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051246, GO:0050794, GO:0001817, GO:0010556, GO:0065007, GO:0051239, GO:0008150, GO:0050789
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0046329 [BP]negative regulation of JNK cascadeprobableGO:0048585, GO:0048583, GO:0023057, GO:0010648, GO:0023051, GO:0046328, GO:0010646, GO:0010627, GO:0050789, GO:0043409, GO:0043408, GO:0009968, GO:0009966, GO:0065007, GO:0048519, GO:0010741, GO:0070302, GO:0070303, GO:0050794, GO:0032872, GO:0032873, GO:0008150, GO:0080134, GO:0080135, GO:0048523
GO:0032088 [BP]negative regulation of NF-kappaB transcription factor activityprobableGO:0080090, GO:0019222, GO:0031326, GO:0031323, GO:0050789, GO:2000112, GO:0060255, GO:0065007, GO:0044092, GO:0065009, GO:0010468, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:2001141, GO:0043433, GO:0051090, GO:0051252, GO:0006355, GO:0010556
GO:2000660 [BP]negative regulation of interleukin-1-mediated signaling pathwayprobableGO:0009968, GO:0001959, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:2000659, GO:0010648, GO:0001960, GO:0023051, GO:0060761, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0060759
GO:0019221 [BP]cytokine-mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0034097, GO:0008150, GO:0071345, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0071310, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0042221, GO:0007154, GO:0070887, GO:0010033, GO:0044699
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0051038 [BP]negative regulation of transcription during meiosisprobableGO:0048610, GO:0009892, GO:0051172, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0022402, GO:0050789, GO:0007049, GO:0080090, GO:0007126, GO:0051321, GO:0000003, GO:2000112, GO:2000113, GO:0008150, GO:0060255, GO:0065007, GO:0044699, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009987, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051037, GO:2001141, GO:0010605, GO:0019222, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0044763, GO:0010558, GO:0048523
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:2000678 [BP]negative regulation of transcription regulatory region DNA bindingprobableGO:0051098, GO:0051101, GO:0051100, GO:2000677, GO:0065007, GO:0043392, GO:0044092, GO:0008150, GO:0065009
GO:0042051 [BP]compound eye photoreceptor developmentprobableGO:0048749, GO:0044707, GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0044699, GO:0042462, GO:0042461, GO:0048869, GO:0048513, GO:0048666, GO:0009887, GO:0032501, GO:0030182, GO:0048592, GO:0009987, GO:0044767, GO:0001654, GO:0048731, GO:0001754, GO:0022008, GO:0001751, GO:0001745, GO:0048699, GO:0007399, GO:0007423, GO:0048856, GO:0044763, GO:0046530, GO:0008150, GO:0032502
GO:0043508 [BP]negative regulation of JUN kinase activityprobableGO:0033673, GO:0009892, GO:0043549, GO:0019220, GO:0080090, GO:0019222, GO:0044092, GO:0048585, GO:0031324, GO:0048583, GO:0043407, GO:0023057, GO:0043405, GO:0010648, GO:0023051, GO:0043506, GO:0046328, GO:0071901, GO:0071900, GO:0010627, GO:0043086, GO:0043409, GO:0043408, GO:0051248, GO:0010646, GO:0010605, GO:0009968, GO:0009966, GO:0051348, GO:0051246, GO:0050789, GO:0060255, GO:0065007, GO:0031399, GO:0048519, GO:0065009, GO:0010741, GO:0006469, GO:0045936, GO:0070302, GO:0031323, GO:0045859, GO:0050794, GO:0032872, GO:0032268, GO:0008150, GO:0042325, GO:0051174, GO:0032269, GO:0042326, GO:0050790, GO:0010563, GO:0031400, GO:0080135, GO:0051338, GO:0001933, GO:0001932, GO:0080134, GO:0048523
GO:0010804 [BP]negative regulation of tumor necrosis factor-mediated signaling pathwayprobableGO:0009968, GO:0001959, GO:0009966, GO:0048583, GO:0048585, GO:0010803, GO:0050794, GO:0008150, GO:0023057, GO:0065007, GO:0010648, GO:0001960, GO:0023051, GO:0060761, GO:0048519, GO:0010646, GO:0050789, GO:0048523, GO:0060759
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0007249 [BP]I-kappaB kinase/NF-kappaB cascadeprobableGO:0044700, GO:0051716, GO:0007243, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0045671 [BP]negative regulation of osteoclast differentiationprobableGO:0002761, GO:0051093, GO:0002762, GO:0051239, GO:0045596, GO:0050793, GO:1902105, GO:0050794, GO:0050789, GO:1902106, GO:0045638, GO:0065007, GO:0002682, GO:0008150, GO:0045670, GO:0048519, GO:2000026, GO:0045595, GO:0045637, GO:0048523

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 89-250
View the alignment between query and template
View the model in PyMOL
Template: 2I13, chain A
Confidence level:very confident
Coverage over the Query: 125-285
View the alignment between query and template
View the model in PyMOL
Template: 1EJ6, chain B
Confidence level:probable
Coverage over the Query: 141-163
View the alignment between query and template
View the model in PyMOL