Psyllid ID: psy8050


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
KKKKKKKKKKKKKKKKKRKKKGILANSSSKEKIQDRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKLPLSS
cccccccccccccccccHHHHHHHHHcccccccEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccHHcccccccHHHHcccccccccccccccccccccccHHHHccccccccccccccccccccccccHHHHcccccccccccccccccccccccccHHHcccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccc
ccccccccccccccEccccccEEHcEcccccccccccccccccccccccccccccccEEEEEEccccccccccccccccEEcccccccEccccHHHHHcHHccccccccccccccccccccccEEccHHHHHHHHccccccccEEccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHccccEEccccccEEccHHHHHHHHHHHHcccccccccccccccHccccEccccHHHEHHHHcccccccccccccHccccEcccccccc
kkkkkkkkKKKKKKKKkrkkkgilanssskekiqdrsecpgsgmgkpphDVADVLLSLKHavvhpgqmtpppygdpgapyqvgapqqfptaslsytvhphqssrgrplnsGIRLILIqfipgktyarpstlkthlrthsgekpyrcedcnkSFSQAANLTAHvrthsgekpfrcpicdrrfsqsssvtthmrthsgerpyrcrlckkafsdsstLTKHlrihsgekpyqcklcllrfsqsgnlnrhmrvhgsqynmlpVIYMGVNQvcsnivdqrrGIYVVEAVWTVQstwidgrstmcghsfivklplss
kkkkkkkkkkkkkkkkkrkkkgilanssskekiqdrsecpgsgmgkPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQssrgrplnsGIRLILIQFIPGKTYARPSTLKThlrthsgekpyRCEDCNKSFSQAANLTAHvrthsgekpfrcpicdrrfsqsssvtthmrthsgerpyrcRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQstwidgrstmcGHSFIVKLPLSS
kkkkkkkkkkkkkkkkkrkkkGILANSSSKEKIQDRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKLPLSS
****************************************************DVLLSLKHAVV**********************************************SGIRLILIQFIPGKTYARPSTLKT************C**C*********LTAHV********FRCPICD*********************YRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKL****
**********************************DRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMG*********DQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKL*L**
********************************************GKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLS************PLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFS***************RPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKLPLSS
****KKKKKKKKKKKKKRKKKGILANSSSKEKIQDRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFI*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
KKKKKKKKKKKKKKKKKRKKKGILANSSSKEKIQDRSECPGSGMGKPPHDVADVLLSLKHAVVHPGQMTPPPYGDPGAPYQVGAPQQFPTASLSYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQYNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTWIDGRSTMCGHSFIVKLPLSS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query311 2.2.26 [Sep-21-2011]
Q24732598 Protein glass OS=Drosophi N/A N/A 0.414 0.215 0.945 1e-69
P13360604 Protein glass OS=Drosophi yes N/A 0.372 0.192 0.945 2e-69
Q966L8279 Transcription factor che- yes N/A 0.360 0.401 0.678 9e-43
P10073491 Zinc finger and SCAN doma yes N/A 0.414 0.262 0.534 1e-38
O75346 499 Zinc finger protein 253 O no N/A 0.469 0.292 0.496 3e-37
Q96JC4 524 Zinc finger protein 479 O no N/A 0.556 0.330 0.477 4e-37
Q15937 498 Zinc finger protein 79 OS no N/A 0.405 0.253 0.527 4e-37
Q6ZNA1 936 Zinc finger protein 836 O no N/A 0.556 0.184 0.415 6e-37
Q147U1533 Zinc finger protein 846 O no N/A 0.411 0.240 0.519 8e-37
Q5R5U3672 Zinc finger protein 271 O no N/A 0.379 0.175 0.558 1e-36
>sp|Q24732|GLAS_DROVI Protein glass OS=Drosophila virilis GN=gl PE=3 SV=1 Back     alignment and function desciption
 Score =  263 bits (672), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 122/129 (94%), Positives = 126/129 (97%)

Query: 122 GKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRF 181
           GKTYARPSTLKTHLRTHSGE+PYRC DCNKSFSQAANLTAHVRTH+G+KPFRCPICDRRF
Sbjct: 433 GKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRF 492

Query: 182 SQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG 241
           SQSSSVTTHMRTHSGERPYRC  CKK+FSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG
Sbjct: 493 SQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG 552

Query: 242 NLNRHMRVH 250
           NLNRHMRVH
Sbjct: 553 NLNRHMRVH 561




Transcription factor required for gene expression specific to photoreceptor cells.
Drosophila virilis (taxid: 7244)
>sp|P13360|GLAS_DROME Protein glass OS=Drosophila melanogaster GN=gl PE=1 SV=2 Back     alignment and function description
>sp|Q966L8|CHE1_CAEEL Transcription factor che-1 OS=Caenorhabditis elegans GN=che-1 PE=1 SV=3 Back     alignment and function description
>sp|P10073|ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens GN=ZSCAN22 PE=2 SV=2 Back     alignment and function description
>sp|O75346|ZN253_HUMAN Zinc finger protein 253 OS=Homo sapiens GN=ZNF253 PE=2 SV=2 Back     alignment and function description
>sp|Q96JC4|ZN479_HUMAN Zinc finger protein 479 OS=Homo sapiens GN=ZNF479 PE=2 SV=1 Back     alignment and function description
>sp|Q15937|ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens GN=ZNF79 PE=1 SV=2 Back     alignment and function description
>sp|Q6ZNA1|ZN836_HUMAN Zinc finger protein 836 OS=Homo sapiens GN=ZNF836 PE=2 SV=2 Back     alignment and function description
>sp|Q147U1|ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens GN=ZNF846 PE=1 SV=2 Back     alignment and function description
>sp|Q5R5U3|ZN271_PONAB Zinc finger protein 271 OS=Pongo abelii GN=ZNF271 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
86515370392 glass [Tribolium castaneum] gi|31415647| 0.446 0.354 0.928 2e-70
270014313392 glass [Tribolium castaneum] 0.446 0.354 0.928 2e-70
242022079266 protein glass, putative [Pediculus human 0.427 0.5 0.969 2e-70
347971715 666 AGAP004331-PA [Anopheles gambiae str. PE 0.398 0.186 0.926 1e-69
328716962 446 PREDICTED: protein glass-like [Acyrthosi 0.450 0.313 0.916 1e-69
40218116136 glass protein [Tribolium castaneum] 0.437 1.0 0.933 8e-69
198451889 592 GA20515, isoform A [Drosophila pseudoobs 0.578 0.304 0.744 1e-68
195145665 592 GL23194 [Drosophila persimilis] gi|19410 0.578 0.304 0.744 1e-68
357608904 477 hypothetical protein KGM_06609 [Danaus p 0.427 0.278 0.939 2e-68
170040215 574 conserved hypothetical protein [Culex qu 0.437 0.236 0.904 2e-68
>gi|86515370|ref|NP_001034508.1| glass [Tribolium castaneum] gi|31415647|gb|AAP46162.1| glass protein [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  272 bits (695), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 129/139 (92%), Positives = 133/139 (95%)

Query: 120 IPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDR 179
           I GK+YARPSTLKTHLRTHSGEKPYRC DCNKSFSQAANLTAHVRTHSGEKPFRCP+CDR
Sbjct: 254 ICGKSYARPSTLKTHLRTHSGEKPYRCIDCNKSFSQAANLTAHVRTHSGEKPFRCPVCDR 313

Query: 180 RFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQ 239
           RFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPY+CKLCLLRFSQ
Sbjct: 314 RFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYECKLCLLRFSQ 373

Query: 240 SGNLNRHMRVHGSQYNMLP 258
           SGNLNRHMRVHG+   M P
Sbjct: 374 SGNLNRHMRVHGAASMMPP 392




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270014313|gb|EFA10761.1| glass [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242022079|ref|XP_002431469.1| protein glass, putative [Pediculus humanus corporis] gi|212516757|gb|EEB18731.1| protein glass, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|347971715|ref|XP_313608.5| AGAP004331-PA [Anopheles gambiae str. PEST] gi|333468996|gb|EAA09224.6| AGAP004331-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|328716962|ref|XP_001947050.2| PREDICTED: protein glass-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|40218116|gb|AAR82970.1| glass protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|198451889|ref|XP_001358547.2| GA20515, isoform A [Drosophila pseudoobscura pseudoobscura] gi|198131689|gb|EAL27688.2| GA20515, isoform A [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195145665|ref|XP_002013812.1| GL23194 [Drosophila persimilis] gi|194102755|gb|EDW24798.1| GL23194 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|357608904|gb|EHJ66204.1| hypothetical protein KGM_06609 [Danaus plexippus] Back     alignment and taxonomy information
>gi|170040215|ref|XP_001847903.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167863762|gb|EDS27145.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query311
FB|FBgn0004618604 gl "glass" [Drosophila melanog 0.421 0.216 0.938 4.7e-74
UNIPROTKB|Q24732598 gl "Protein glass" [Drosophila 0.430 0.224 0.925 1.2e-73
WB|WBGene00000483279 che-1 [Caenorhabditis elegans 0.360 0.401 0.678 5.7e-43
ZFIN|ZDB-GENE-110913-156308 si:dkey-179k24.6 "si:dkey-179k 0.475 0.480 0.510 5.3e-40
UNIPROTKB|J9P5A4491 ZSCAN22 "Uncharacterized prote 0.414 0.262 0.542 6.8e-40
RGD|2322471495 Zscan22 "zinc finger and SCAN 0.414 0.260 0.542 8.7e-40
UNIPROTKB|O75346 499 ZNF253 "Zinc finger protein 25 0.469 0.292 0.496 1.8e-39
UNIPROTKB|P10073491 ZSCAN22 "Zinc finger and SCAN 0.414 0.262 0.534 2.9e-39
UNIPROTKB|E1BBB9 475 ZNF79 "Uncharacterized protein 0.530 0.347 0.456 4.8e-39
UNIPROTKB|G3N141 552 ZNF79 "Uncharacterized protein 0.530 0.298 0.456 4.8e-39
FB|FBgn0004618 gl "glass" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 686 (246.5 bits), Expect = 4.7e-74, Sum P(2) = 4.7e-74
 Identities = 123/131 (93%), Positives = 128/131 (97%)

Query:   122 GKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRF 181
             GKTYARPSTLKTHLRTHSGE+PYRC DCNKSFSQAANLTAHVRTH+G+KPFRCPICDRRF
Sbjct:   443 GKTYARPSTLKTHLRTHSGERPYRCPDCNKSFSQAANLTAHVRTHTGQKPFRCPICDRRF 502

Query:   182 SQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG 241
             SQSSSVTTHMRTHSGERPYRC  CKK+FSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG
Sbjct:   503 SQSSSVTTHMRTHSGERPYRCSSCKKSFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG 562

Query:   242 NLNRHMRVHGS 252
             NLNRHMRVHG+
Sbjct:   563 NLNRHMRVHGN 573


GO:0001752 "compound eye photoreceptor fate commitment" evidence=IMP
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0003677 "DNA binding" evidence=IMP
GO:0042051 "compound eye photoreceptor development" evidence=NAS
GO:0009649 "entrainment of circadian clock" evidence=IMP
GO:0045944 "positive regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043153 "entrainment of circadian clock by photoperiod" evidence=IMP
GO:0010114 "response to red light" evidence=IMP
GO:0035271 "ring gland development" evidence=IMP
GO:0007605 "sensory perception of sound" evidence=IMP
UNIPROTKB|Q24732 gl "Protein glass" [Drosophila virilis (taxid:7244)] Back     alignment and assigned GO terms
WB|WBGene00000483 che-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-110913-156 si:dkey-179k24.6 "si:dkey-179k24.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|J9P5A4 ZSCAN22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|2322471 Zscan22 "zinc finger and SCAN domain containing 22" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O75346 ZNF253 "Zinc finger protein 253" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P10073 ZSCAN22 "Zinc finger and SCAN domain-containing protein 22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BBB9 ZNF79 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3N141 ZNF79 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q966L8CHE1_CAEELNo assigned EC number0.67850.36010.4014yesN/A
P10073ZSC22_HUMANNo assigned EC number0.53480.41470.2627yesN/A
Q24732GLAS_DROVINo assigned EC number0.94570.41470.2157N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 1e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 2e-05
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 3e-04
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 3e-04
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 4e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 4e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 6e-04
pfam0855590 pfam08555, DUF1754, Eukaryotic family of unknown f 8e-04
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 9e-04
PHA00733128 PHA00733, PHA00733, hypothetical protein 0.001
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.002
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.002
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 0.002
pfam09831177 pfam09831, DUF2058, Uncharacterized protein conser 0.002
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 0.003
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.003
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.003
pfam03343603 pfam03343, SART-1, SART-1 family 0.003
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 0.003
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.004
PRK14552414 PRK14552, PRK14552, C/D box methylation guide ribo 0.004
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 0.004
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 0.004
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
 Score = 41.2 bits (97), Expect = 1e-05
 Identities = 15/26 (57%), Positives = 21/26 (80%)

Query: 158 NLTAHVRTHSGEKPFRCPICDRRFSQ 183
           NL  H+RTH+GEKP++CP+C + FS 
Sbjct: 1   NLRRHMRTHTGEKPYKCPVCGKSFSS 26


Length = 26

>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|219901 pfam08555, DUF1754, Eukaryotic family of unknown function (DUF1754) Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|177301 PHA00733, PHA00733, hypothetical protein Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|220431 pfam09831, DUF2058, Uncharacterized protein conserved in bacteria (DUF2058) Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|217502 pfam03343, SART-1, SART-1 family Back     alignment and domain information
>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|237753 PRK14552, PRK14552, C/D box methylation guide ribonucleoprotein complex aNOP56 subunit; Provisional Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 311
KOG2462|consensus279 99.95
KOG2462|consensus279 99.93
KOG3608|consensus467 99.91
KOG3608|consensus467 99.87
KOG1074|consensus 958 99.87
KOG1074|consensus 958 99.83
KOG3623|consensus 1007 99.81
KOG3623|consensus 1007 99.74
KOG3576|consensus267 99.67
KOG3576|consensus267 99.63
PLN03086567 PRLI-interacting factor K; Provisional 99.15
PLN03086567 PRLI-interacting factor K; Provisional 99.12
PHA00733128 hypothetical protein 99.02
PHA00733128 hypothetical protein 98.93
PHA0276855 hypothetical protein; Provisional 98.75
KOG3993|consensus500 98.74
KOG3993|consensus500 98.72
PHA0276855 hypothetical protein; Provisional 98.62
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.51
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.34
PHA0061644 hypothetical protein 98.14
PHA0073279 hypothetical protein 98.06
PHA0061644 hypothetical protein 98.05
PHA0073279 hypothetical protein 97.97
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.78
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.74
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.53
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.52
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.46
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.37
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.36
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.22
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.22
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.01
COG5189423 SFP1 Putative transcriptional repressor regulating 96.81
smart0035526 ZnF_C2H2 zinc finger. 96.6
COG5189423 SFP1 Putative transcriptional repressor regulating 96.58
KOG2231|consensus 669 96.41
KOG2231|consensus 669 96.4
smart0035526 ZnF_C2H2 zinc finger. 96.08
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.0
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.98
COG5236 493 Uncharacterized conserved protein, contains RING Z 95.93
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.91
PRK04860160 hypothetical protein; Provisional 95.7
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 95.69
COG5048467 FOG: Zn-finger [General function prediction only] 95.5
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 95.4
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.36
KOG1146|consensus 1406 94.99
PRK04860160 hypothetical protein; Provisional 94.86
KOG2482|consensus423 94.85
COG5048467 FOG: Zn-finger [General function prediction only] 94.45
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 94.37
KOG1146|consensus 1406 94.18
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 93.93
KOG2785|consensus 390 93.08
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 93.02
KOG4173|consensus253 92.72
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.18
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 92.05
COG5236 493 Uncharacterized conserved protein, contains RING Z 92.02
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 90.68
KOG2482|consensus423 89.95
KOG2893|consensus 341 89.19
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 88.79
TIGR00622112 ssl1 transcription factor ssl1. This family is bas 88.73
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 88.19
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 88.17
KOG2893|consensus 341 86.74
PF06524314 NOA36: NOA36 protein; InterPro: IPR010531 This fam 86.2
PF12013109 DUF3505: Protein of unknown function (DUF3505); In 85.0
PF09986 214 DUF2225: Uncharacterized protein conserved in bact 83.32
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 82.69
KOG2186|consensus276 82.43
COG404965 Uncharacterized protein containing archaeal-type C 80.2
>KOG2462|consensus Back     alignment and domain information
Probab=99.95  E-value=1.3e-28  Score=204.03  Aligned_cols=138  Identities=36%  Similarity=0.654  Sum_probs=126.5

Q ss_pred             CCCcceeeccCCCCcCCChhHHHHHHhhhCC---CCCeecCcCccccCChhHHHHHHHHhcCCCceecCCCCccccCcch
Q psy8050         110 SGIRLILIQFIPGKTYARPSTLKTHLRTHSG---EKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSS  186 (311)
Q Consensus       110 ~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~---~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~  186 (311)
                      ......++|..||+.|.+.++|.+|.+.|-.   .+.+.|++|+++|.+...|..|+++|+  .+++|.+||+.|...+.
T Consensus       125 ~~~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWL  202 (279)
T KOG2462|consen  125 AAKHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWL  202 (279)
T ss_pred             cccCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHH
Confidence            3455678999999999999999999998864   467999999999999999999999996  57899999999999999


Q ss_pred             hhhhhhhccccccccccccccccCChHHHHHHhhhhcCCCCeecCccccccCChHHHHHHHHH
Q psy8050         187 VTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRV  249 (311)
Q Consensus       187 l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~  249 (311)
                      |+-|+++|+||+||.|+.|+++|...++|+.|+++|.+.+.|+|..|++.|...+.|..|...
T Consensus       203 LQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLnKH~ES  265 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLNKHSES  265 (279)
T ss_pred             hhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHHHhhhh
Confidence            999999999999999999999999999999999999999999999999999999999999764



>KOG2462|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>KOG2785|consensus Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>KOG2482|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>TIGR00622 ssl1 transcription factor ssl1 Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>PF06524 NOA36: NOA36 protein; InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues Back     alignment and domain information
>PF12013 DUF3505: Protein of unknown function (DUF3505); InterPro: IPR022698 This family of proteins is functionally uncharacterised Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>KOG2186|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 6e-35
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 1e-21
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 2e-24
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 5e-21
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 5e-21
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 1e-20
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-20
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 2e-20
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-20
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-20
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 4e-20
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 7e-20
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 3e-19
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 1e-17
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 4e-09
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 9e-17
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-16
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-12
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 5e-16
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 3e-14
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 5e-16
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 4e-12
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 7e-16
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 2e-15
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-15
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 4e-14
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 7e-14
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 1e-11
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 4e-13
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 6e-13
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 7e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-12
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-12
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 1e-08
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-11
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 3e-11
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 9e-11
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-10
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 1e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 4e-10
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 6e-10
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 1e-09
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 8e-09
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 3e-07
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 1e-07
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 1e-05
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 2e-07
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 7e-07
2yrj_A46 Solution Structure Of The C2h2-Type Zinc Finger Dom 1e-05
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 1e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 2e-06
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 3e-06
2ct1_A77 Solution Structure Of The Zinc Finger Domain Of Tra 4e-04
2enh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-06
2emh_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-06
2en6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-06
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 2e-05
3uk3_C57 Crystal Structure Of Znf217 Bound To Dna Length = 5 6e-05
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-05
2yta_A41 Solution Structure Of C2h2 Type Zinc Finger Domain 8e-04
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 3e-05
2ytb_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 5e-04
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 3e-05
1bbo_A57 High-Resolution Solution Structure Of The Double Cy 4e-04
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-05
2ytq_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ep3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-05
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
2emk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-05
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-05
2em3_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2ytf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2em2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-05
2em2_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 8e-05
2ep0_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2ytm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-05
2yth_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-05
2eq2_A46 Solution Structure Of The 16th C2h2 Type Zinc Finge 1e-04
2ytg_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2em9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2em9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eol_A42 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2eog_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2yrh_A44 Solution Structure Of The C2h2-Type Zinc Finger Dom 2e-04
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2emm_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2ysv_A42 Solution Structure Of C2h2 Type Zinc Finger Domain 2e-04
2elz_A46 Solution Structure Of The 17th Zf-C2h2 Domain From 2e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2eml_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ena_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2emj_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eor_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eon_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emy_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2eq1_A46 Solution Structure Of The 9th C2h2 Type Zinc Finger 3e-04
2eq1_A46 Solution Structure Of The 9th C2h2 Type Zinc Finger 5e-04
2ene_A46 Solution Structure Of The C2h2 Type Zinc Finger (re 3e-04
2yts_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 3e-04
2emw_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2em6_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2epz_A46 Solution Structure Of The 4th C2h2 Type Zinc Finger 4e-04
2en9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2en9_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2eow_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2eom_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2eof_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 5e-04
2eq3_A46 Solution Structure Of The 17th C2h2 Type Zinc Finge 5e-04
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 5e-04
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 5e-04
2ytp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2ep1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 6e-04
2en2_A42 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-04
2eq4_A46 Solution Structure Of The 11th C2h2 Type Zinc Finge 8e-04
1xf7_A29 High Resolution Nmr Structure Of The Wilms' Tumor S 9e-04
2emp_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-04
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure

Iteration: 1

Score = 144 bits (363), Expect = 6e-35, Method: Compositional matrix adjust. Identities = 68/129 (52%), Positives = 86/129 (66%) Query: 122 GKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRF 181 GK+++ L H RTH+GEKPY+C +C KSFSQ ANL AH RTH+GEKP+ CP C + F Sbjct: 56 GKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSF 115 Query: 182 SQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG 241 SQ + + H RTH+GE+PY+C C K+FS L H R H+GEKPY+C C FS+ Sbjct: 116 SQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRD 175 Query: 242 NLNRHMRVH 250 LN H R H Sbjct: 176 ALNVHQRTH 184
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YRJ|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (781- 813) From Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2CT1|A Chain A, Solution Structure Of The Zinc Finger Domain Of Transcriptional Repressor Ctcf Protein Length = 77 Back     alignment and structure
>pdb|2ENH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 556- 588) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 491- 523) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EN6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 887- 919) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|3UK3|C Chain C, Crystal Structure Of Znf217 Bound To Dna Length = 57 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2YTA|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 3 In Zinc Finger Protein 32 Length = 41 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure
>pdb|2YTB|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 5 In Zinc Finger Protein 32 Length = 42 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|1BBO|A Chain A, High-Resolution Solution Structure Of The Double Cys2His2 Zinc Finger From The Human Enhancer Binding Protein Mbp-1 Length = 57 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2YTQ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 775- 807) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EP3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 631- 663) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 668- 700) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EM3|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 640- 672) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 607- 639) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EM2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 584- 616) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EM2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 584- 616) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EP0|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 528- 560) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 696- 728) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2YTH|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 479- 511) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EQ2|A Chain A, Solution Structure Of The 16th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 369- 401) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EM9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 367- 399) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EM9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 367- 399) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EOL|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 581- 609) Of Human Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|2EOG|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 693- 723) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2YRH|A Chain A, Solution Structure Of The C2h2-Type Zinc Finger Domain (699- 729) From Zinc Finger Protein 473 Length = 44 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EMM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 544- 576) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2YSV|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 17 In Zinc Finger Protein 473 Length = 42 Back     alignment and structure
>pdb|2ELZ|A Chain A, Solution Structure Of The 17th Zf-C2h2 Domain From Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2EML|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 752- 784) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2ENA|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 311- 343) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EMJ|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 612- 644) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EOR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 255- 287) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EON|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 397- 429) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EMY|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 551- 583) Of Human Zinc Finger Protein 268 Length = 46 Back     alignment and structure
>pdb|2EQ1|A Chain A, Solution Structure Of The 9th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EQ1|A Chain A, Solution Structure Of The 9th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2ENE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (region 592- 624) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTS|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 715- 747) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EMW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 301- 331) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EM6|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 199- 231) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2EPZ|A Chain A, Solution Structure Of The 4th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EN9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 415- 447) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EN9|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 415- 447) Of Human Zinc Finger Protein 28 Homolog Length = 46 Back     alignment and structure
>pdb|2EOW|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 368- 400) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EOM|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 341- 373) Of Human Zinc Finger Protein 95 Homolog Length = 46 Back     alignment and structure
>pdb|2EOF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 411- 441) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EQ3|A Chain A, Solution Structure Of The 17th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2YTP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 687- 719) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EP1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 435- 467) Of Human Zinc Finger Protein 484 Length = 46 Back     alignment and structure
>pdb|2EN2|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 598- 626) Of Human B-Cell Lymphoma 6 Protein Length = 42 Back     alignment and structure
>pdb|2EQ4|A Chain A, Solution Structure Of The 11th C2h2 Type Zinc Finger Domain Of Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|1XF7|A Chain A, High Resolution Nmr Structure Of The Wilms' Tumor Suppressor Protein (Wt1) Finger 3 Length = 29 Back     alignment and structure
>pdb|2EMP|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 536- 568) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query311
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-60
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-59
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-58
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 5e-49
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-57
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-47
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-46
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-56
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 1e-49
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-55
1tf6_A190 Protein (transcription factor IIIA); complex (tran 4e-49
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-47
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-36
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-53
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 4e-49
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 1e-22
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 5e-52
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 3e-50
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-05
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-52
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-42
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 2e-35
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 5e-28
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-51
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-42
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 4e-39
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 5e-51
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-44
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 3e-21
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-49
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-39
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-35
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 3e-24
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 3e-45
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-41
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-37
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 2e-42
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 3e-36
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 1e-29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 3e-40
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 1e-34
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-32
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 1e-37
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 5e-35
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 7e-33
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-37
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 4e-36
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 2e-33
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 2e-36
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 9e-34
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 3e-32
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 8e-35
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-33
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 2e-26
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-18
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-33
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 7e-33
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-24
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 4e-19
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-33
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-32
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-28
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 3e-20
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-32
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 6e-31
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 2e-28
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 5e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 4e-31
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-29
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 1e-25
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 8e-19
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 5e-11
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 5e-31
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-29
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 1e-21
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 9e-20
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 7e-30
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-29
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 6e-25
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-19
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-28
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-26
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 7e-24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-28
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 7e-26
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-25
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 6e-16
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-26
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-24
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 4e-22
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 9e-15
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-25
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 4e-23
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-20
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 5e-15
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 5e-22
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 7e-22
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-18
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 4e-16
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-21
2epa_A72 Krueppel-like factor 10; transforming growth facto 5e-19
2epa_A72 Krueppel-like factor 10; transforming growth facto 3e-18
2epa_A72 Krueppel-like factor 10; transforming growth facto 9e-14
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 5e-20
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-19
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 9e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-10
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 8e-05
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-19
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 6e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 7e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-06
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-18
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 8e-18
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 3e-14
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-09
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 4e-05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-18
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-17
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-05
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-18
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-17
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-18
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-18
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-16
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-09
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-18
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-17
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-15
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-18
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-18
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-17
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-14
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-05
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-18
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-16
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-14
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-18
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-17
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-09
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-18
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-15
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-18
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-14
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 9e-18
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-17
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-05
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-18
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-16
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-04
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-18
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-16
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-14
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-10
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-04
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-17
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-14
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-09
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 7e-05
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-17
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-17
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-10
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-06
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-17
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-16
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-14
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 8e-10
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-05
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-17
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-17
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-14
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-05
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-17
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-13
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-05
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-17
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-14
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-17
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-17
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-16
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-13
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-09
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-05
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-16
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-13
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-05
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-17
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-17
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-17
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-17
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-17
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-14
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-10
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 6e-05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-17
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-17
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-09
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-05
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-17
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-17
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 7e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 6e-05
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-17
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-17
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-05
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-13
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-04
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-17
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-05
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-17
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-16
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-16
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 9e-11
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-17
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-16
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-13
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-10
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 7e-05
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-10
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-17
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-16
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-05
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-17
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-16
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-13
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-17
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-17
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-14
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-17
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-17
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 4e-14
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 2e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 7e-05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-17
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-14
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-10
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-05
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-17
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-16
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-17
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-17
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-14
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-09
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-05
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-17
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 8e-17
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-14
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-09
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-05
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-17
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-14
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-10
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-17
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-14
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-06
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-17
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-17
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-17
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-17
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-16
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-14
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-10
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-05
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-17
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-16
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-14
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-05
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-17
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-17
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 9e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-05
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-17
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-17
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-17
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-16
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-13
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-05
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-17
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-16
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-13
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-10
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-04
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-17
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-16
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-05
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-14
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-05
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 4e-17
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 5e-17
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-16
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-10
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 1e-05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-17
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-17
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-17
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-14
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-05
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-17
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 5e-17
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 3e-14
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-05
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-17
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-14
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-05
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-17
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-10
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-05
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-17
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-17
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-04
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 6e-17
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-16
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 2e-08
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 8e-05
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-17
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-04
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-17
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-17
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-04
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-17
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-17
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-14
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-10
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-17
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-16
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 6e-14
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-05
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-16
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 2e-15
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-16
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-16
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-09
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-16
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 4e-16
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-13
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-05
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-16
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-16
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-05
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-16
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-13
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-05
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-16
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-16
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-13
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-04
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-16
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-13
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 8e-05
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-16
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-14
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 5e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-05
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-16
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-15
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-05
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-16
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-09
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-16
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-15
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-07
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 3e-05
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 3e-16
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 7e-16
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 6e-15
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 4e-16
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 6e-16
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-14
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 9e-05
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-16
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-16
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 9e-14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 8e-07
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-05
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-16
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 7e-16
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 4e-10
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-16
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-12
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-07
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-05
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-15
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 6e-15
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-05
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 4e-15
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-14
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 1e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-12
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 8e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 5e-15
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 6e-14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 8e-14
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 2e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-14
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-13
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 3e-12
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 4e-08
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-11
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 4e-14
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 2e-13
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-10
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 6e-09
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 8e-14
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 1e-13
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 2e-10
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 5e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-13
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 5e-12
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-06
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 3e-12
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-10
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 1e-09
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-09
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 6e-12
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 7e-10
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-05
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-10
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 7e-10
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-09
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-05
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 3e-10
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 6e-10
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 7e-09
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 2e-09
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 8e-09
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 5e-08
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 1e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 5e-05
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 7e-07
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 1e-06
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 6e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 1e-06
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 5e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 3e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 6e-05
1ard_A29 Yeast transcription factor ADR1; transcription reg 9e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 5e-06
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 5e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 6e-04
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 8e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 8e-06
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 2e-05
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 3e-05
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 4e-05
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 5e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 1e-04
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 2e-04
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
 Score =  189 bits (484), Expect = 2e-60
 Identities = 68/129 (52%), Positives = 86/129 (66%)

Query: 122 GKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRF 181
           GK+++    L  H RTH+GEKPY+C +C KSFSQ ANL AH RTH+GEKP+ CP C + F
Sbjct: 56  GKSFSDKKDLTRHQRTHTGEKPYKCPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSF 115

Query: 182 SQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSG 241
           SQ + +  H RTH+GE+PY+C  C K+FS    L  H R H+GEKPY+C  C   FS+  
Sbjct: 116 SQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGEKPYKCPECGKSFSRRD 175

Query: 242 NLNRHMRVH 250
            LN H R H
Sbjct: 176 ALNVHQRTH 184


>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Length = 35 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Length = 29 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 100.0
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.97
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.96
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.94
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.93
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.91
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.91
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.9
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.89
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.89
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.88
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.88
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.87
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.87
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.79
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.79
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.77
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.77
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.77
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.77
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.76
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.76
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.75
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.75
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.75
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.73
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.73
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.72
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.71
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.68
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.68
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.68
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.67
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.65
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.64
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.63
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.62
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.62
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.6
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.59
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.58
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.58
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.57
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.55
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.54
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.51
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.51
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.51
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.51
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.5
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.48
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.47
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.47
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.47
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.46
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.46
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.46
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.45
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.44
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.42
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.42
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.41
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.41
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.4
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.38
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.37
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.36
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.35
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.35
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.34
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.33
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.32
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.31
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.27
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.24
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.23
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.2
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.19
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.18
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.18
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.18
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.18
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.17
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.17
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.17
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.16
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.16
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.15
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.15
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.15
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.14
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.14
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.14
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.14
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.13
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.12
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.12
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.11
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.11
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.11
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.1
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.1
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.06
1vd4_A62 Transcription initiation factor IIE, alpha subunit 99.06
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.06
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.04
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.04
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.04
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.04
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.04
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.03
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.03
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.03
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.03
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.03
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.02
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.02
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.02
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.02
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.02
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.02
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.02
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.02
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.02
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.01
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.01
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.01
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.01
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.01
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.01
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.0
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.0
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.0
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.0
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.99
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.99
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.99
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 98.99
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.99
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.99
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.99
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.99
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.99
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.98
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.97
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.97
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.97
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.97
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.96
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.96
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.96
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.95
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.95
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.95
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.95
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 98.95
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.94
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.94
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.94
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.93
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.93
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.91
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.9
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.9
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.88
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.88
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.88
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.87
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.87
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.87
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.87
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.86
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.86
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.86
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.86
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.85
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.85
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.85
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.85
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.84
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.84
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.84
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.84
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.84
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.83
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.83
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.82
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.82
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.82
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.81
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.8
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.79
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.79
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.79
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.79
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.79
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.78
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.78
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.76
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.74
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.73
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.72
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.72
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.7
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.66
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.65
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.6
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.56
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.55
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.54
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.48
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.47
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.47
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.44
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.42
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.42
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.4
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.4
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.36
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.36
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.31
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.3
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.3
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.27
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.26
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.25
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.24
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.23
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.19
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.19
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.16
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.15
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.12
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.12
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.08
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.08
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.08
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.07
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.06
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.04
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.04
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.03
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.03
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.01
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.01
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.98
1ard_A29 Yeast transcription factor ADR1; transcription reg 97.98
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 97.97
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.97
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 97.97
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 97.96
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.95
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 97.94
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.92
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 97.9
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.9
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 97.9
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.11
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.88
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 97.88
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.08
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 97.86
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 97.86
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 97.84
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 97.83
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 97.82
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.03
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.01
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.01
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.74
1paa_A30 Yeast transcription factor ADR1; transcription reg 97.73
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 96.76
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.6
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.41
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.37
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.15
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 96.38
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 96.04
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.66
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.58
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 95.4
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.34
2e72_A49 POGO transposable element with ZNF domain; zinc fi 93.83
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 92.3
2e72_A49 POGO transposable element with ZNF domain; zinc fi 92.24
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 91.89
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 91.64
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 89.59
2k5c_A95 Uncharacterized protein PF0385; structural genomic 88.65
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 86.34
2k5c_A95 Uncharacterized protein PF0385; structural genomic 81.81
2k9h_A57 Glycoprotein; hantavirus, zinc finger, CCHC, metal 81.51
1wjv_A79 Cell growth regulating nucleolar protein LYAR; DNA 80.92
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
Probab=100.00  E-value=2.1e-36  Score=249.80  Aligned_cols=183  Identities=40%  Similarity=0.752  Sum_probs=131.7

Q ss_pred             CccccCCCCCCCCCCCCCCcceeeccCCCCcCCChhHHHHHHhhhCCCCCeecCcCccccCChhHHHHHHHHhcCCCcee
Q psy8050          94 SYTVHPHQSSRGRPLNSGIRLILIQFIPGKTYARPSTLKTHLRTHSGEKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFR  173 (311)
Q Consensus        94 ~~~~h~~~~~~~~~~~~~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~h~~~~~~~  173 (311)
                      .|..|+..+.++++        +.|.+|++.|.+...|..|++.|+++++|.|+.|++.|.+...|..|+..|+++.+|.
T Consensus         8 ~l~~h~~~~~~~~~--------~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~   79 (190)
T 2i13_A            8 SSVAQAALEPGEKP--------YACPECGKSFSRSDHLAEHQRTHTGEKPYKCPECGKSFSDKKDLTRHQRTHTGEKPYK   79 (190)
T ss_dssp             -------------------------------CCSSHHHHHGGGCC---CCEECTTTCCEESSHHHHHHHHHHHHCCCCEE
T ss_pred             cchhhhhhcCCCCC--------CcCCCCccccCCHHHHHHHHHHcCCCCCccCCCcCchhCCHHHHHHHHHhcCCCCCcc
Confidence            34445555544433        4577888888888888888888888888888888888888888888888888888888


Q ss_pred             cCCCCccccCcchhhhhhhhccccccccccccccccCChHHHHHHhhhhcCCCCeecCccccccCChHHHHHHHHHhCCC
Q psy8050         174 CPICDRRFSQSSSVTTHMRTHSGERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVHGSQ  253 (311)
Q Consensus       174 C~~C~~~f~~~~~l~~H~~~h~~~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~  253 (311)
                      |+.|++.|.+...|..|+..|+++++|.|++|++.|.+...|..|+++|+++++|.|++|++.|.+...|..|+++|.++
T Consensus        80 C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H~~~  159 (190)
T 2i13_A           80 CPECGKSFSQRANLRAHQRTHTGEKPYACPECGKSFSQLAHLRAHQRTHTGEKPYKCPECGKSFSREDNLHTHQRTHTGE  159 (190)
T ss_dssp             CTTTCCEESCHHHHHHHHHHHHTCCCEECTTTCCEESSHHHHHHHHHHHHCCCCEECTTTCCEESCHHHHHHHHHHHHCC
T ss_pred             CcccCCccCCHHHHHHHHHhcCCCCCCcCCCCCCccCCHHHHHHHHHHhCCCCCeECCCCCcccCCHHHHHHHHHhcCCC
Confidence            88888888888888888888888888888888888888888888888888888888888888888888888888888876


Q ss_pred             CCCCCcccccccccccccccccccchhhceeeeecccc
Q psy8050         254 YNMLPVIYMGVNQVCSNIVDQRRGIYVVEAVWTVQSTW  291 (311)
Q Consensus       254 ~~~~~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~  291 (311)
                      .   ++    .|++|++.|.+...|..|++.|+++++|
T Consensus       160 ~---~~----~C~~C~~~f~~~~~L~~H~~~H~~~k~~  190 (190)
T 2i13_A          160 K---PY----KCPECGKSFSRRDALNVHQRTHTGKKTS  190 (190)
T ss_dssp             C---CE----ECTTTCCEESSHHHHHHHHTTC------
T ss_pred             C---Ce----ECCCCCCccCCHHHHHHHHHhcCCCCCC
Confidence            6   33    6888888888888888888888887664



>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2k5c_A Uncharacterized protein PF0385; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Pyrococcus furiosus} Back     alignment and structure
>2k9h_A Glycoprotein; hantavirus, zinc finger, CCHC, metal binding protein; NMR {Andes virus} Back     alignment and structure
>1wjv_A Cell growth regulating nucleolar protein LYAR; DNA-binding protein, C2H2 type zinc-finger, structural genomics; NMR {Mus musculus} SCOP: g.37.1.2 g.37.1.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 311
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-13
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 7e-12
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 1e-11
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-08
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 6e-12
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 7e-12
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-10
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-12
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 8e-12
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-11
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-05
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 2e-05
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-12
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 3e-11
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 4e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 5e-11
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 1e-10
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 2e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 9e-11
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 6e-10
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-09
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 7e-10
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-09
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-08
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 6e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 4e-09
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 1e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-08
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 8e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 0.002
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 9e-09
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 1e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 3e-08
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 6e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 5e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 8e-08
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 9e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-08
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-07
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-07
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 2e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-06
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-04
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 8e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 9e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 2e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-07
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 0.001
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-07
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 1e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 8e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 2e-06
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 9e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-04
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 1e-05
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 7e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 3e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 1e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-05
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.004
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 3e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 9e-05
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 0.001
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 9e-05
d2dmda329 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 { 0.002
d2dmda128 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 { 2e-04
d2epqa132 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [ 2e-04
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.001
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 0.002
d2epra135 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [ 0.003
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 61.2 bits (148), Expect = 3e-13
 Identities = 17/54 (31%), Positives = 29/54 (53%), Gaps = 1/54 (1%)

Query: 141 EKPYRCEDCNKSFSQAANLTAHVRTHSGEKPFRCPICDRRFSQSSSVTTHMRTH 194
           +K Y C+ C KSF+  +    H+  H G +P+ C +C ++F     +  HM+ H
Sbjct: 1   DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query311
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.59
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.52
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.13
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.13
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.1
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.1
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.07
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.02
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.01
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.96
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.96
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.93
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.91
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.87
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.82
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.82
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.79
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.78
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.78
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.74
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.73
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.73
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.72
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.71
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.68
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.64
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.55
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.55
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.51
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.51
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.41
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.39
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.29
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.28
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.26
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.21
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.21
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.14
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.08
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.01
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.98
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.93
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.88
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.86
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.85
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.73
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.7
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.57
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.53
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.49
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.48
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.34
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.31
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.18
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.16
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.12
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 97.09
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.99
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.97
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.94
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.87
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.83
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.77
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.67
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.66
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.59
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 96.55
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.52
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 96.48
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 96.41
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.31
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.28
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 96.27
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.18
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.09
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.99
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.95
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.82
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 95.76
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.74
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 95.55
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 95.39
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 95.28
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 95.26
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.78
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 94.34
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 94.19
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.99
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 93.94
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 93.43
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.64
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 92.27
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 92.25
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 92.13
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 91.91
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 90.96
d1y0jb136 U-shaped transcription factor, different fingers { 90.48
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 90.42
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.16
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 90.05
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 89.79
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 89.26
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 88.63
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 87.86
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 87.52
d1y0jb136 U-shaped transcription factor, different fingers { 86.42
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 85.65
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 85.42
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 84.17
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 83.01
d1vd4a_62 Transcription initiation factor TFIIE-alpha {Human 82.87
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 82.43
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 81.2
d1x6fa175 Zinc finger protein 462, ZNF462 {Human (Homo sapie 80.71
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 80.27
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.59  E-value=3.3e-16  Score=98.85  Aligned_cols=53  Identities=34%  Similarity=0.843  Sum_probs=46.3

Q ss_pred             cccccccccccccCChHHHHHHhhhhcCCCCeecCccccccCChHHHHHHHHHh
Q psy8050         197 ERPYRCRLCKKAFSDSSTLTKHLRIHSGEKPYQCKLCLLRFSQSGNLNRHMRVH  250 (311)
Q Consensus       197 ~k~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~C~~C~~~f~~~~~L~~H~~~H  250 (311)
                      |++|.|+ ||+.|.....|..|+++|+|++||.|.+||+.|.+.+.|..|+++|
T Consensus         1 EK~y~C~-Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPCQ-CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEECT-TSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCCC-CCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            5788894 9999999999999998999999999999999999999999988876



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1vd4a_ g.41.3.1 (A:) Transcription initiation factor TFIIE-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x6fa1 g.37.1.1 (A:8-82) Zinc finger protein 462, ZNF462 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure