Diaphorina citri psyllid: psy8052


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-------
MVTSLSLLFGSSPDFLGVVVLEIERSIISQMLRKSVEAKDWLHGIEPRNVRAVMKRIIEELTLVDNQ
cHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcc
******LLFGSSPDFLGVVVLEIERSIISQMLRKSVEAKDWLHGIEPRNVRAVMKRIIEELTLV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTSLSLLFGSSPDFLGVVVLEIERSIISQMLRKSVEAKDWLHGIEPRNVRAVMKRIIEELTLVDNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 51 homolog confidentQ8MSY4
Vacuolar protein sorting-associated protein 51 homolog Required for both Golgi structure and vesicular trafficking, and ultimately lipid transport.confidentQ9UID3
Vacuolar protein sorting-associated protein 51 homolog Regulator of vesicle recycling and protein sorting. Required for both Golgi structure and vesicular trafficking, and ultimately lipid transport.confidentQ155U0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042147 [BP]retrograde transport, endosome to GolgiprobableGO:0016197, GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006914 [BP]autophagyprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056
GO:0000938 [CC]GARP complexprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031982, GO:0016023, GO:0031410, GO:0031988, GO:0044433, GO:0044431, GO:0005794, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BA3, chain A
Confidence level:probable
Coverage over the Query: 14-36
View the alignment between query and template
View the model in PyMOL