Diaphorina citri psyllid: psy8055


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MDLFFYLNAENASKWCNANGSWNSFANYSLCTDIKKTTQDLSEPGIEITTMIYSVGYTLSLIALIIAVWIFVYFKDLRCLRNKIHTNLMCTYILADFMWILTMTVQMSVQSNFACVILYIFLHYCHLTNFFWMFVEGSR
cccccccccccEEEEcccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHcHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc
MDLFFYLNAENASKWCNANGSWNSFANYSLCTDIKKTTQDLSEPGIEITTMIYSVGYTLSLIALIIAVWIFVYFKDLRCLRNKIHTNLMCTYILADFMWILTMTVQMSVQSNFACVILYIFLHYCHLTNFFWMFVEGSR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLFFYLNAENASKWCNANGSWNSFANYSLCTDIKKTTQDLSEPGIEITTMIYSVGYTLSLIALIIAVWIFVYFKDLRCLRNKIHTNLMCTYILADFMWILTMTVQMSVQSNFACVILYIFLHYCHLTNFFWMFVEGSR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007188 [BP]adenylate cyclase-modulating G-protein coupled receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0050789, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0007187, GO:0044699
GO:0048585 [BP]negative regulation of response to stimulusprobableGO:0008150, GO:0048519, GO:0065007, GO:0048583, GO:0050789
GO:0001653 [MF]peptide receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0017046 [MF]peptide hormone bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0042562, GO:0005488
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0023051 [BP]regulation of signalingprobableGO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0032870 [BP]cellular response to hormone stimulusprobableGO:0071495, GO:0009719, GO:0051716, GO:0009725, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0080090 [BP]regulation of primary metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0007204 [BP]elevation of cytosolic calcium ion concentrationprobableGO:0019725, GO:0072507, GO:0072503, GO:0051480, GO:0006874, GO:0050801, GO:0009987, GO:0006873, GO:0048878, GO:0042592, GO:0006875, GO:0065007, GO:0044763, GO:0055074, GO:0030003, GO:0055065, GO:0055080, GO:0008150, GO:0055082, GO:0065008, GO:0044699
GO:0004930 [MF]G-protein coupled receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0045937 [BP]positive regulation of phosphate metabolic processprobableGO:0019220, GO:0009893, GO:0019222, GO:0010562, GO:0031323, GO:0050794, GO:0051174, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0031325, GO:0048522
GO:0010646 [BP]regulation of cell communicationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0031328 [BP]positive regulation of cellular biosynthetic processprobableGO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0009889, GO:0050794, GO:0031323, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1U34, chain A
Confidence level:confident
Coverage over the Query: 5-40
View the alignment between query and template
View the model in PyMOL
Template: 2Z73, chain A
Confidence level:probable
Coverage over the Query: 75-137
View the alignment between query and template
View the model in PyMOL
Template: 3EML, chain A
Confidence level:probable
Coverage over the Query: 51-136
View the alignment between query and template
View the model in PyMOL