Diaphorina citri psyllid: psy8072


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580----
MSKRGVDCEDASSSGQPPVKKVQFEPIRIGPISTLEEMDIKVLKFQNKKLAQRIEQKNQVEHELRSRIEQLEKRQTQDDAVLNVVNRYWNQLNEDIRILLQRFDAETADESESKSQAALRALDVCAPPAYGNTNVMCLAITDENEATTSFLMQLSTWDKEELDEKLANRVQVSKRAVAKIIQAFDRLVQRNEKITMILKGELNNSNGDPIPSLDEAVREANIEIQTENRNLTEQNTKLHAKYHSISLKISELQDAVNGKETEAAELRNQIDDLQYELSKVQSRNDKLENHLLEATEKVKLCQQMHTEDGKEKDVIKPEETMSNVSQKKLDDLQKDLEEAKELANNRLQELDKLHLQHREALKDVEKLKMDWEVTFNNEISWLVWSVNPTSLTTQLPRQIRQLPESVIVETTEYKCLQSAYSVLYNENQLAKTQAQEFQSHLSASKNNQQRQIEMMETEELMVQKKLRGEMMQLEDALSQIRKEYEMLRIEFETNLAANEQTGPINREMRHLITSLQNHNKQIKGEVNRYKRKYKETSAEIQKVRISERSPWPSGYRLHAGGSGFDSRWGRSFSLCLMFGVHSAS
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHcHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHcccccHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccc
***********************FEPIRIGPISTLEEMDIKVLKFQN*******************************DAVLNVVNRYWNQLNEDIRILLQRFD**************************************ENEATTSFLMQLSTWDKEELDEKLANRVQVSKRAVAKIIQAFDRLVQRNEKITMILKG*****************************************YH*I************************************************************************************************************HLQHREALKDVEKLKMDWEVTFNNEISWLVWSVNPTSLTTQLPRQIRQLPESVIVETTEYKCLQSAYSVLYNEN****************************************************IRKEYEMLRIEFETNLA***************I**************************************WPSGYR***GGSGFDSRWGRSFSLCLMFGVHS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKRGVDCEDASSSGQPPVKKVQFEPIRIGPISTLEEMDIKVLKFQxxxxxxxxxxxxxxxxxxxxxxxxxxxxQTQDDAVLNVVNRYWNQLNEDIRILLQRFDAETADESESKSQAALRALDVCAPPAYGNTNVMCLAITDENEATTSFLMQLSTWDKEELDEKLANRVQVSKRAVAKIIQAFDRLVQRNEKITMILKGELNNSNGDPIPSLDEAxxxxxxxxxxxxxxxxxxxxxLHAKYHSISLKxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHTEDGKEKDVIKPEETMxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxWEVTFNNEISWLVWSVNPTSLTTQLPRQIRQLPESVIVETTEYKCLQSAYSVLYNENQLAKTQAQEFQSHLSASKNNQQRQIEMMETEELMVxxxxxxxxxxxxxxxxxxxxxxxxxxxxFETNLAANEQTGPINREMRHLxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxERSPWPSGYRLHAGGSGFDSRWGRSFSLCLMFGVHSAS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
E3 ubiquitin-protein ligase Bre1 E3 ubiquitin-protein ligase that mediates monoubiquitination of 'Lys-117' of histone H2B. H2B 'Lys-117' ubiquitination gives a specific tag for epigenetic transcriptional activation and is also prerequisite for histone H3 'Lys-4' and 'Lys-79' methylation. It thereby plays a central role in histone code and gene regulation. Required for the expression of Notch target genes in development by affecting the levels of Su(H) in imaginal disk cells and stimulating the Su(H)-mediated transcription of Notch-specific genes.confidentQ9VRP9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1I84, chain S
Confidence level:very confident
Coverage over the Query: 538-548
View the alignment between query and template
View the model in PyMOL
Template: 2DFS, chain A
Confidence level:confident
Coverage over the Query: 466-495,506-531
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 429-546
View the alignment between query and template
View the model in PyMOL
Template: 3S4R, chain A
Confidence level:probable
Coverage over the Query: 224-282
View the alignment between query and template
View the model in PyMOL
Template: 2V71, chain A
Confidence level:probable
Coverage over the Query: 331-370
View the alignment between query and template
View the model in PyMOL
Template: 3O0Z, chain A
Confidence level:probable
Coverage over the Query: 212-296,307-308,326-370
View the alignment between query and template
View the model in PyMOL
Template: 3GHG, chain A
Confidence level:probable
Coverage over the Query: 330-370,395-451,467-501
View the alignment between query and template
View the model in PyMOL