Diaphorina citri psyllid: psy8088


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MSDDDRMSLTTAVSDEEDVESAHISPYRAKQTGTAAASFNCTGIRYLPGGVASGFNHVDINAPGEKKLYQIKGKKNIRVRQVALSVGSMNKGDCFALDTGREVLVYVGSKAARTERLKAISVANQIRDQDHNGRATVSIIDENSSPVEVTRFFTELGSGSNNQVADVPYGGDDAEFETKQDKAVKLYKISDASGNVKSELIEQIPLAQKSLNQGDTFILDTVTSGIYVWIGKDSTTAEKVEGLKRGQAFLTNNNYPAWTKTGEIKTSLEVWAEEKEEALVHQ
ccHHHHHHHHHHHHHccccccccEEEECccccccHHHHcccccCEEccccccccccccccccccccEEEEEEECcCEEEEEEEccccccccccEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHcccccccCEEEEEccccccHHHHHHHHHHcccccccccccccccccHHHHHHHccccEEEEEEcccccEEEEEEEEccccccccccccEEEEEccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccCEEEEEccEEEEccccccccccc
*SDDDRMSLTTAVSDEEDVES***********GTAAASFNCTGIRYLPGGVASGFNHVDINAPGEKKLYQIKGKKNIRVRQVALSVGSMNKGDCFALDTGREVLVYVGSKAARTERLKAISVANQIRDQDHNGRATVSIIDENSSPVEVTRFFTELGSGSNNQ******GGDDAEFETKQDKAVKLYKISDASGNVKSELIEQIPLAQKSLNQGDTFILDTVTSGIYVWIGKDSTTAEKVEGLKRGQAFLTNNNYPAWTKTGEIKTSLEVWAEE********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDDDRMSLTTAVSDEEDVESAHISPYRAKQTGTAAASFNCTGIRYLPGGVASGFNHVDINAPGEKKLYQIKGKKNIRVRQVALSVGSMNKGDCFALDTGREVLVYVGSKAARTERLKAISVANQIRDQDHNGRATVSIIDENSSPVEVTRFFTELGSGSNNQVADVPYGGDDAEFETKQDKAVKLYKISDASGNVKSELIEQIPLAQKSLNQGDTFILDTVTSGIYVWIGKDSTTAEKVEGLKRGQAFLTNNNYPAWTKTGEIKTSLEVWAEEKEEALVHQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Gelsolin Calcium-regulated, actin-modulating protein that binds to the plus (or barbed) ends of actin monomers or filaments, preventing monomer exchange (end-blocking or capping). It can promote the assembly of monomers into filaments (nucleation) as well as sever filaments already formed.confidentQ07171

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0031252 [CC]cell leading edgeprobableGO:0005575, GO:0044464, GO:0005623
GO:0051015 [MF]actin filament bindingprobableGO:0003779, GO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0051014 [BP]actin filament severingprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0030029
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0005546 [MF]phosphatidylinositol-4,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030833 [BP]regulation of actin filament polymerizationprobableGO:0033043, GO:0051128, GO:0008064, GO:0050789, GO:0044699, GO:0030832, GO:0051493, GO:0016043, GO:0090066, GO:0065007, GO:0071840, GO:0065008, GO:0032271, GO:0032970, GO:0009987, GO:0050794, GO:0044763, GO:0032956, GO:0043254, GO:0044087, GO:0008150, GO:0032535
GO:0051179 [BP]localizationprobableGO:0008150
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008154 [BP]actin polymerization or depolymerizationprobableGO:0006996, GO:0007015, GO:0007010, GO:0071822, GO:0030029, GO:0043933, GO:0071840, GO:0009987, GO:0030036, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0005884 [CC]actin filamentprobableGO:0043234, GO:0005856, GO:0032991, GO:0015629, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0005575, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005576 [CC]extracellular regionprobableGO:0005575

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1D0N, chain A
Confidence level:very confident
Coverage over the Query: 4-278
View the alignment between query and template
View the model in PyMOL