Diaphorina citri psyllid: psy8112

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------

PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDLLDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPPPKRVHSKSGKK

ccEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEccEEEECcccccccccccccccEEEEcccccccccHHHHHHHHcccccccccccEEEEcccEEEEEEEccccHHHHHHHHHHHHHcccccccCCccccEEEEEEEEEcccccEEEEEEEEccccccccEEEEEEccccccccccccEEEEcEEEEcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHcccccHHHHHHHccccccccccccEEEECccEEEEEEEcccccccHHHHHHHHHHHHcccccCCcccccccEEEEEEEcccccccccccccccccHHHHHHHccccHHHHHcccccccccccccEEEECccEEEEEEEcccccHHHHHHHHHHHcccccccCECcccccEEEEEEEEcccccEEEEEEEcccccccccEEEEEEEcccccccccccEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccHHHHHHHHcccEEEEccEEEEEEcHHHHHHHHHHHcccccccEEcccccCECccccccccccccc

PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRF*********************DRKITRNQKRRHDEINH******************HEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRW**************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Histone acetyltransferase KAT8	Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. As part of the MSL complex it is involved in acetylation of nucleosomal histone H4 producing specifically H4K16ac. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. That activity is less specific than the one of the MSL complex.	confident	Q9D1P2
Histone acetyltransferase KAT8	Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. As part of the MSL complex it is involved in acetylation of nucleosomal histone H4 producing specifically H4K16ac. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. That activity is less specific than the one of the MSL complex.	confident	Q5XI06
Histone acetyltransferase KAT8	Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. As part of the MSL complex it is involved in acetylation of nucleosomal histone H4 producing specifically H4K16ac. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. That activity is less specific than the one of the MSL complex.	confident	Q9H7Z6

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0046972 [MF]	histone acetyltransferase activity (H4-K16 specific)	probable	GO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0043981 [BP]	histone H4-K5 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0071339 [CC]	MLL1 complex	probable	GO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422, GO:0044665
GO:0043982 [BP]	histone H4-K8 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0008134 [MF]	transcription factor binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0043995 [MF]	histone acetyltransferase activity (H4-K5 specific)	probable	GO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0043996 [MF]	histone acetyltransferase activity (H4-K8 specific)	probable	GO:0008080, GO:0004402, GO:0016740, GO:0003824, GO:0016407, GO:0016746, GO:0016747, GO:0016410, GO:0003674, GO:0010485
GO:0000776 [CC]	kinetochore	probable	GO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0035064 [MF]	methylated histone residue binding	probable	GO:0042393, GO:0003674, GO:0005488, GO:0005515
GO:0072487 [CC]	MSL complex	probable	GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0030099 [BP]	myeloid cell differentiation	probable	GO:0032502, GO:0002376, GO:0009987, GO:0044707, GO:0048856, GO:0048869, GO:0032501, GO:0030154, GO:0044767, GO:0048513, GO:0044763, GO:0008150, GO:0048731, GO:0030097, GO:0048534, GO:0007275, GO:0044699, GO:0002520
GO:0006302 [BP]	double-strand break repair	probable	GO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:0044699, GO:0006281, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0032703 [BP]	negative regulation of interleukin-2 production	probable	GO:0051241, GO:0008150, GO:0001817, GO:0065007, GO:0051239, GO:0048519, GO:0032663, GO:0050789, GO:0001818
GO:0006978 [BP]	DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator	probable	GO:0044700, GO:0051716, GO:0030330, GO:0042772, GO:0050896, GO:0009987, GO:0008150, GO:0044699, GO:0050794, GO:0006974, GO:0006950, GO:0065007, GO:0044763, GO:0007165, GO:0033554, GO:0007154, GO:0035556, GO:0023052, GO:0072331, GO:0050789, GO:0042770
GO:0000790 [CC]	nuclear chromatin	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0043984 [BP]	histone H4-K16 acetylation	probable	GO:0043543, GO:0006473, GO:0006475, GO:0016043, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0018394, GO:0018193, GO:0071704, GO:0016570, GO:0016573, GO:0018393, GO:0043967, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0018205, GO:0044237, GO:0043170, GO:0019538, GO:0044763, GO:0016568, GO:0016569
GO:0019899 [MF]	enzyme binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0046872 [MF]	metal ion binding	probable	GO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0006357 [BP]	regulation of transcription from RNA polymerase II promoter	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0006351 [BP]	transcription, DNA-dependent	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0019438
GO:0032777 [CC]	Piccolo NuA4 histone acetyltransferase complex	probable	GO:0031974, GO:0043229, GO:0035267, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0043189, GO:0005654, GO:0044451, GO:0043231, GO:0043234, GO:0032991, GO:0000123, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045893 [BP]	positive regulation of transcription, DNA-dependent	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PQ8, chain A
Confidence level:very confident
Coverage over the Query: 107-226,524-675
View the alignment between query and template
View the model in PyMOL

Template: 2OZU, chain A
Confidence level:very confident
Coverage over the Query: 315-415
View the alignment between query and template
View the model in PyMOL

Template: 1WGS, chain A
Confidence level:very confident
Coverage over the Query: 1-104
View the alignment between query and template
View the model in PyMOL

Template: 2GIV, chain A
Confidence level:very confident
Coverage over the Query: 452-675
View the alignment between query and template
View the model in PyMOL

Template: 2RC4, chain A
Confidence level:very confident
Coverage over the Query: 112-307
View the alignment between query and template
View the model in PyMOL