Psyllid ID: psy8112

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDLLDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPPPKRVHSKSGKK
ccEEEEEEEcccccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccHHHccccccccccccccccccccccccHHHHHHHHHcccccccccEEEEccEEEEEcccccccccccccccEEEEcccccccccHHHHHHHHcccccccccccEEEEcccEEEEEEEccccHHHHHHHHHHHHHcccccccEEccccEEEEEEEEEcccccEEEEEEEEccccccccEEEEEEccccccccccccEEEEcEEEEcccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHcccccHHHHHHHccccccccccccEEEEEccEEEEEEEcccccccHHHHHHHHHHHHcccccEEcccccccEEEEEEEcccccccccccccccccHHHHHHHccccHHHHHcccccccccccccEEEEEccEEEEEEEcccccHHHHHHHHHHHcccccccEEEcccccEEEEEEEEcccccEEEEEEEcccccccccEEEEEEEcccccccccccEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccHHHHHHHHcccEEEEccEEEEEEcHHHHHHHHHHHcccccccEEcccccEEEccccccccccccc
ccEEEEEEcccccccEEEEEEEEcccccHHccccHHHcccccccccccccccccccccccccccccccccccccccccHHHHHccHHHccccccccccccccEEccccccEEEEccEEEccccccccccccccccEEEEccccccEEccHHHHHHHHccccccccccEEEEEcccEEEEEEEHHHcHHHHHHHHHHHHccccccccccccccEEEEEEEEEEccEEEEEEEEEEEccccccEEEccEEEcHHHccccHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccccccccccccEEEEccccccEEccHHHHHHHHccccccccccEEEEEcccEEEEEEEHHHcHHHHHHHHHHHHccccccccccccccEEEEEEEEEEccEEcccccccccEEEEEEEEEEccEEEEEEEEEHccccccccccEEEEEcccEEEEEEEHHHcHHHHHHHHHHHHccccccccccccccEEEEEEEEEEccEEEEEEEEEEEccccccEEEccEEEcHHHccccHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccEEHHHHHHHccccHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHcccccEEcHHHccccccccccccccccc
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRImnsrfdmseQHWKNKENQAIDLLDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMigkceidtwyfspypdeckkkpklwICEFCLKYMtmertyryhksectychppgkeiyrcgnisiyevdgsfHKLYCQNLCLLAKLFLdhktlyfdvdpFLFYILCVIDKYGAHLVgyfskekespdgnnvaciltlppyqrqgygKFLISFSYELSkvegligspekplsdlgklsyrSYWSWVLLGIlrnsnffpfkpvvrtssrstrfpieckkkpklwICEFCLKYMtmertyryhksectychppgkeiyrcgnisiyevdgsfHKLYCQNLCLLAKLFLdhktlyfdvdpFLFYILCVIdkydhktlyfdvdpFLFYILCVIDKYGAHLvgyfsksectychppgkeiyrcgnisiyevdgsfHKLYCQNLCLLAKLFLdhktlyfdvdpFLFYILCVIDKYGAHLVgyfskekespdgnnvaciltlppyqrqgygKFLISFSYELSkvegligspekplsdlgklsyrSYWSWVLLGILRnskgnsttIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQStqykrprlqvdptylrwtpppkrvhsksgkk
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKEnqaidlldqsdrkitrnqkrrhdeinhvqktyeemdPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPypdeckkkpkLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIgspekplsdlgkLSYRSYWSWVLLGILRNSNFFPFKpvvrtssrstrfpieckkkpklwicEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIgspekplsdlgklSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQstqykrprlqvdptylrwtpppkrvhsksgkk
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDLLDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPPPKRVHSKSGKK
****IQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRF********************************************************HEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKE*****GNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKE*****GNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRW**************
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRF*********************DRKITRNQKRRHDEINH****************************DKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGL**SPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGL*GSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQ**Q*****LQVDPTYLRW**************
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDLLDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPP***********
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMN*******************************************K*YEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPPP**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDLLDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPPPKRVHSKSGKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query687 2.2.26 [Sep-21-2011]
Q9D1P2458 Histone acetyltransferase yes N/A 0.441 0.661 0.723 1e-131
Q5XI06458 Histone acetyltransferase yes N/A 0.441 0.661 0.723 1e-131
Q9H7Z6458 Histone acetyltransferase yes N/A 0.441 0.661 0.723 1e-130
O02193827 Males-absent on the first yes N/A 0.442 0.367 0.550 1e-103
Q8LI34450 Putative MYST-like histon yes N/A 0.422 0.644 0.556 4e-89
Q9FLF7445 Probable MYST-like histon yes N/A 0.423 0.653 0.552 1e-85
Q9LXD7445 MYST-like histone acetylt no N/A 0.423 0.653 0.552 3e-85
C8VBH4508 Histone acetyltransferase no N/A 0.356 0.482 0.513 2e-72
Q75BY2435 Histone acetyltransferase yes N/A 0.406 0.641 0.459 2e-72
P0CP02564 Histone acetyltransferase yes N/A 0.311 0.379 0.580 2e-72
>sp|Q9D1P2|KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus GN=Kat8 PE=1 SV=1 Back     alignment and function desciption
 Score =  468 bits (1203), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 220/304 (72%), Positives = 258/304 (84%), Gaps = 1/304 (0%)

Query: 2   AEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDLL 61
           AE+IQ+R N+ E   E+YVHY GFNRRLDEWV K+R+  ++  + +   KN E    +L 
Sbjct: 73  AEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTK-TVKDAVQKNSEKYLSELA 131

Query: 62  DQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDT 121
           +Q +RKITRNQKR+HDEINHVQKTY EMDPTTAALEKEHEAITKVKY+DKI IG  EID 
Sbjct: 132 EQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDA 191

Query: 122 WYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEV 181
           WYFSP+P++  K+PKLW+CE+CLKYM  E++YR+H  +C +  PPGKEIYR  NIS+YEV
Sbjct: 192 WYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEV 251

Query: 182 DGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDG 241
           DG  HK+YCQNLCLLAKLFLDHKTLYFDV+PF+FYIL  +D+ GAH+VGYFSKEKESPDG
Sbjct: 252 DGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDG 311

Query: 242 NNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLG 301
           NNVACILTLPPYQR+GYGKFLI+FSYELSK+E  +GSPEKPLSDLGKLSYRSYWSWVLL 
Sbjct: 312 NNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLE 371

Query: 302 ILRN 305
           ILR+
Sbjct: 372 ILRD 375
Histone acetyltransferase which may be involved in transcriptional activation. May influence the function of ATM. As part of the MSL complex it is involved in acetylation of nucleosomal histone H4 producing specifically H4K16ac. As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. That activity is less specific than the one of the MSL complex.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 4EC: 8
>sp|Q5XI06|KAT8_RAT Histone acetyltransferase KAT8 OS=Rattus norvegicus GN=Kat8 PE=2 SV=1 Back     alignment and function description
>sp|Q9H7Z6|KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens GN=KAT8 PE=1 SV=2 Back     alignment and function description
>sp|O02193|MOF_DROME Males-absent on the first protein OS=Drosophila melanogaster GN=mof PE=1 SV=1 Back     alignment and function description
>sp|Q8LI34|MYST1_ORYSJ Putative MYST-like histone acetyltransferase 1 OS=Oryza sativa subsp. japonica GN=Os07g0626600 PE=3 SV=1 Back     alignment and function description
>sp|Q9FLF7|MYST1_ARATH Probable MYST-like histone acetyltransferase 1 OS=Arabidopsis thaliana GN=HAG4 PE=2 SV=1 Back     alignment and function description
>sp|Q9LXD7|MYST2_ARATH MYST-like histone acetyltransferase 2 OS=Arabidopsis thaliana GN=HAG5 PE=2 SV=1 Back     alignment and function description
>sp|C8VBH4|ESA1_EMENI Histone acetyltransferase esa1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=esa1 PE=3 SV=1 Back     alignment and function description
>sp|Q75BY2|ESA1_ASHGO Histone acetyltransferase ESA1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ESA1 PE=3 SV=2 Back     alignment and function description
>sp|P0CP02|ESA1_CRYNJ Histone acetyltransferase ESA1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ESA1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
418208496450 histone acetyltransferase [Nilaparvata l 0.443 0.677 0.823 1e-152
242012343456 myst histone acetyltransferase, putative 0.409 0.616 0.791 1e-145
345491988423 PREDICTED: probable histone acetyltransf 0.443 0.721 0.807 1e-145
350412135490 PREDICTED: probable histone acetyltransf 0.443 0.622 0.798 1e-144
383859760455 PREDICTED: histone acetyltransferase KAT 0.443 0.670 0.798 1e-144
66509734455 PREDICTED: probable histone acetyltransf 0.443 0.670 0.798 1e-144
380025566455 PREDICTED: histone acetyltransferase KAT 0.443 0.670 0.798 1e-143
340727573508 PREDICTED: probable histone acetyltransf 0.443 0.600 0.798 1e-143
322794273454 hypothetical protein SINV_08278 [Solenop 0.442 0.669 0.800 1e-142
307187701452 Probable histone acetyltransferase MYST1 0.442 0.672 0.800 1e-142
>gi|418208496|gb|AFX63158.1| histone acetyltransferase [Nilaparvata lugens] Back     alignment and taxonomy information
 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 252/306 (82%), Positives = 279/306 (91%)

Query: 1   PAEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDL 60
           PAEIIQ RYNE + C+EYYVHY+GFNRRLDEWV ++RIMNSRFDMS+Q WKN +  +IDL
Sbjct: 62  PAEIIQTRYNEQDTCYEYYVHYEGFNRRLDEWVPRNRIMNSRFDMSDQQWKNSDRNSIDL 121

Query: 61  LDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEID 120
           LDQSDRKITRNQKRRHDEINH+QKTY EMDPTTAALEKEHEAITKVKYIDKI IGK EID
Sbjct: 122 LDQSDRKITRNQKRRHDEINHIQKTYAEMDPTTAALEKEHEAITKVKYIDKIQIGKFEID 181

Query: 121 TWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYE 180
           TWY+SPYPDE KK+PKLWICEFCL+YM +E+TYRYH SEC +  PPGKEIYR G ++I+E
Sbjct: 182 TWYYSPYPDEYKKQPKLWICEFCLRYMRLEKTYRYHMSECAWRQPPGKEIYRKGTLTIWE 241

Query: 181 VDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPD 240
            DGS +KLYCQNLCLLAKLFLDHKTLYFDV+PFLFYILC  DKYG+HLVGYFSKEKESPD
Sbjct: 242 ADGSQYKLYCQNLCLLAKLFLDHKTLYFDVEPFLFYILCETDKYGSHLVGYFSKEKESPD 301

Query: 241 GNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLL 300
           GNNVACILTLPPYQRQGYGK LI+FSYELSK+E  +GSPEKPLSDLGKLSYRSYWSWVLL
Sbjct: 302 GNNVACILTLPPYQRQGYGKLLIAFSYELSKIERAVGSPEKPLSDLGKLSYRSYWSWVLL 361

Query: 301 GILRNS 306
            +LR++
Sbjct: 362 DVLRDT 367

Source: Nilaparvata lugens

Species: Nilaparvata lugens

Genus: Nilaparvata

Family: Delphacidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242012343|ref|XP_002426892.1| myst histone acetyltransferase, putative [Pediculus humanus corporis] gi|212511121|gb|EEB14154.1| myst histone acetyltransferase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345491988|ref|XP_001600240.2| PREDICTED: probable histone acetyltransferase MYST1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350412135|ref|XP_003489552.1| PREDICTED: probable histone acetyltransferase MYST1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383859760|ref|XP_003705360.1| PREDICTED: histone acetyltransferase KAT8-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66509734|ref|XP_625075.1| PREDICTED: probable histone acetyltransferase MYST1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380025566|ref|XP_003696541.1| PREDICTED: histone acetyltransferase KAT8-like [Apis florea] Back     alignment and taxonomy information
>gi|340727573|ref|XP_003402116.1| PREDICTED: probable histone acetyltransferase MYST1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322794273|gb|EFZ17437.1| hypothetical protein SINV_08278 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307187701|gb|EFN72673.1| Probable histone acetyltransferase MYST1 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query687
ZFIN|ZDB-GENE-030131-7510502 kat8 "K(lysine) acetyltransfer 0.442 0.605 0.733 1.9e-124
UNIPROTKB|E2QT63458 MYST1 "Uncharacterized protein 0.441 0.661 0.723 1.9e-124
MGI|MGI:1915023458 Kat8 "K(lysine) acetyltransfer 0.441 0.661 0.723 1.9e-124
RGD|1311512458 Kat8 "K (lysine) acetyltransfe 0.441 0.661 0.723 1.9e-124
UNIPROTKB|F1MP98458 KAT8 "Uncharacterized protein" 0.441 0.661 0.723 2.4e-124
UNIPROTKB|Q9H7Z6458 KAT8 "Histone acetyltransferas 0.441 0.661 0.723 2.4e-124
UNIPROTKB|F1RIR8458 MYST1 "Uncharacterized protein 0.441 0.661 0.723 2.4e-124
UNIPROTKB|K7GPZ7439 MYST1 "Uncharacterized protein 0.441 0.690 0.723 2.4e-124
FB|FBgn0014340827 mof "males absent on the first 0.353 0.293 0.679 5.9e-101
DICTYBASE|DDB_G0279699657 DDB_G0279699 "HAM group protei 0.372 0.389 0.638 5.3e-98
ZFIN|ZDB-GENE-030131-7510 kat8 "K(lysine) acetyltransferase 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1223 (435.6 bits), Expect = 1.9e-124, P = 1.9e-124
 Identities = 223/304 (73%), Positives = 256/304 (84%)

Query:     2 AEIIQNRYNELENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAIDLL 61
             AE+IQ+R NE E   E+YVHY GFNRRLDEWV K R+  ++          +E    +L+
Sbjct:   116 AEVIQSRLNEQEGREEFYVHYVGFNRRLDEWVGKARLALTKTVKDAVRKSVEEGGGGELV 175

Query:    62 DQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDT 121
             DQ +RKITRNQKR+HDEINHVQKTY EMDPTTAALEKEHEAITKVKY+DKI IG  EID 
Sbjct:   176 DQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIQIGNFEIDA 235

Query:   122 WYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEV 181
             WYFSP+P++  K+PKLWICE+CLKYM  E+T+RYH S+C +  PPGKEIYR  NIS+YEV
Sbjct:   236 WYFSPFPEDYGKQPKLWICEYCLKYMKYEKTFRYHLSQCQWRQPPGKEIYRKNNISVYEV 295

Query:   182 DGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDG 241
             DG  HK+YCQNLCLLAKLFLDHKTLYFDV+PF+FYIL  ++K GAH+VGYFSKEKESPDG
Sbjct:   296 DGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFIFYILTEVNKQGAHIVGYFSKEKESPDG 355

Query:   242 NNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLG 301
             NNVACILTLPPYQR+GYGKFLI+FSYELSK+E  +GSPEKPLSDLGKLSYRSYWSWVLL 
Sbjct:   356 NNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLE 415

Query:   302 ILRN 305
             ILR+
Sbjct:   416 ILRD 419
GO:0005634 "nucleus" evidence=IEA
GO:0016747 "transferase activity, transferring acyl groups other than amino-acyl groups" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
UNIPROTKB|E2QT63 MYST1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1915023 Kat8 "K(lysine) acetyltransferase 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311512 Kat8 "K (lysine) acetyltransferase 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MP98 KAT8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H7Z6 KAT8 "Histone acetyltransferase KAT8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIR8 MYST1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|K7GPZ7 MYST1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0014340 mof "males absent on the first" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0279699 DDB_G0279699 "HAM group protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2UMQ5ESA1_ASPOR2, ., 3, ., 1, ., 4, 80.52780.33330.4525yesN/A
Q9FLF7MYST1_ARATH2, ., 3, ., 1, ., 4, 80.55220.42350.6539yesN/A
Q8LI34MYST1_ORYSJ2, ., 3, ., 1, ., 4, 80.55660.42210.6444yesN/A
Q4IEV4ESA1_GIBZE2, ., 3, ., 1, ., 4, 80.53700.30850.4223yesN/A
O02193MOF_DROME2, ., 3, ., 1, ., -0.55070.44250.3675yesN/A
Q6C710ESA1_YARLI2, ., 3, ., 1, ., 4, 80.55150.32160.4712yesN/A
Q5XI06KAT8_RAT2, ., 3, ., 1, ., 4, 80.72360.44100.6615yesN/A
Q9D1P2KAT8_MOUSE2, ., 3, ., 1, ., 4, 80.72360.44100.6615yesN/A
Q9H7Z6KAT8_HUMAN2, ., 3, ., 1, ., 4, 80.72360.44100.6615yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!
3rd Layer2.3.1.480.737

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
PLN00104450 PLN00104, PLN00104, MYST -like histone acetyltrans 1e-136
PLN00104450 PLN00104, PLN00104, MYST -like histone acetyltrans 1e-121
pfam01853189 pfam01853, MOZ_SAS, MOZ/SAS family 1e-111
PLN03238290 PLN03238, PLN03238, probable histone acetyltransfe 1e-107
COG5027395 COG5027, SAS2, Histone acetyltransferase (MYST fam 1e-105
PLN03238290 PLN03238, PLN03238, probable histone acetyltransfe 1e-101
COG5027395 COG5027, SAS2, Histone acetyltransferase (MYST fam 2e-90
pfam01853189 pfam01853, MOZ_SAS, MOZ/SAS family 9e-90
PLN03239351 PLN03239, PLN03239, histone acetyltransferase; Pro 3e-84
PTZ00064552 PTZ00064, PTZ00064, histone acetyltransferase; Pro 2e-83
PLN03239351 PLN03239, PLN03239, histone acetyltransferase; Pro 7e-77
PTZ00064552 PTZ00064, PTZ00064, histone acetyltransferase; Pro 2e-58
PLN00104450 PLN00104, PLN00104, MYST -like histone acetyltrans 2e-44
PLN03238290 PLN03238, PLN03238, probable histone acetyltransfe 8e-40
COG5027395 COG5027, SAS2, Histone acetyltransferase (MYST fam 2e-37
pfam01853189 pfam01853, MOZ_SAS, MOZ/SAS family 2e-35
PTZ00064552 PTZ00064, PTZ00064, histone acetyltransferase; Pro 7e-29
PLN03239351 PLN03239, PLN03239, histone acetyltransferase; Pro 5e-28
pfam1171755 pfam11717, Tudor-knot, RNA binding activity-knot o 3e-11
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information 
 Score =  408 bits (1051), Expect = e-136
 Identities = 165/312 (52%), Positives = 207/312 (66%), Gaps = 18/312 (5%)

Query: 1   PAEIIQNRYNELE--NCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWKNKENQAI 58
           P ++I+ R       N +EYYVHY  FNRRLDEWV+       + D+        E    
Sbjct: 72  PVKVIERRRGGSGGPNDYEYYVHYTEFNRRLDEWVKL-----EQLDLDTVETVGDEK--- 123

Query: 59  DLLDQSDRKITRNQKRRHDEINHVQKTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCE 118
                +  K+TR+QKR+ DE +  +  +EE+D    A  +EHE  TKVK I  I +G+ E
Sbjct: 124 VEDKVASLKMTRHQKRKIDETHVEEG-HEELDA---ASLREHEEFTKVKNIATIELGRYE 179

Query: 119 IDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCG---- 174
           IDTWYFSP+P E     KL+ CEFCLK+M  +   + H  +C   HPPG EIYR      
Sbjct: 180 IDTWYFSPFPPEYNDCSKLYFCEFCLKFMKRKEQLQRHMKKCDLKHPPGDEIYRHPTRQE 239

Query: 175 NISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSK 234
            +S++EVDG  +K+YCQNLC LAKLFLDHKTLY+DVD FLFY+LC  D  G H+VGYFSK
Sbjct: 240 GLSMFEVDGKKNKVYCQNLCYLAKLFLDHKTLYYDVDLFLFYVLCECDDRGCHMVGYFSK 299

Query: 235 EKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSY 294
           EK S +  N+ACILTLPPYQR+GYGKFLI+FSYELSK EG +G+PE+PLSDLG +SYR Y
Sbjct: 300 EKHSEEDYNLACILTLPPYQRKGYGKFLIAFSYELSKREGKVGTPERPLSDLGLVSYRGY 359

Query: 295 WSWVLLGILRNS 306
           W+ VLL IL+  
Sbjct: 360 WTRVLLEILKKH 371

Length = 450
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family Back     alignment and domain information
>gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family Back     alignment and domain information
>gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215056 PLN00104, PLN00104, MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215642 PLN03238, PLN03238, probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>gnl|CDD|227360 COG5027, SAS2, Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|216741 pfam01853, MOZ_SAS, MOZ/SAS family Back     alignment and domain information
>gnl|CDD|173359 PTZ00064, PTZ00064, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178777 PLN03239, PLN03239, histone acetyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|152153 pfam11717, Tudor-knot, RNA binding activity-knot of a chromodomain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 687
PTZ00064552 histone acetyltransferase; Provisional 100.0
PLN00104450 MYST -like histone acetyltransferase; Provisional 100.0
PLN03239351 histone acetyltransferase; Provisional 100.0
KOG2747|consensus396 100.0
PLN03238290 probable histone acetyltransferase MYST; Provision 100.0
COG5027395 SAS2 Histone acetyltransferase (MYST family) [Chro 100.0
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 100.0
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 100.0
KOG2747|consensus396 100.0
PLN00104450 MYST -like histone acetyltransferase; Provisional 100.0
PLN03238290 probable histone acetyltransferase MYST; Provision 100.0
PTZ00064552 histone acetyltransferase; Provisional 100.0
PLN03239351 histone acetyltransferase; Provisional 100.0
COG5027395 SAS2 Histone acetyltransferase (MYST family) [Chro 100.0
PF1171755 Tudor-knot: RNA binding activity-knot of a chromod 99.24
cd0002455 CHROMO Chromatin organization modifier (chromo) do 96.41
smart0029855 CHROMO Chromatin organization modifier domain. 95.98
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 94.37
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 94.23
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 93.73
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 93.54
PRK07757152 acetyltransferase; Provisional 93.09
PF1232477 HTH_15: Helix-turn-helix domain of alkylmercury ly 92.58
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 92.03
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 91.9
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 91.9
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 91.77
PHA01807153 hypothetical protein 91.67
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 91.23
PRK10514145 putative acetyltransferase; Provisional 91.22
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 91.0
PRK07757152 acetyltransferase; Provisional 90.96
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 90.55
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 90.07
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 89.82
PRK09831147 putative acyltransferase; Provisional 89.66
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 89.54
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 89.17
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 89.12
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 89.09
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 88.87
PHA01807153 hypothetical protein 88.77
PTZ00330147 acetyltransferase; Provisional 88.73
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 88.56
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 88.52
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 87.99
PLN02825515 amino-acid N-acetyltransferase 87.82
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 87.72
PRK10514145 putative acetyltransferase; Provisional 87.49
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 87.49
PRK09831147 putative acyltransferase; Provisional 87.02
PRK10140162 putative acetyltransferase YhhY; Provisional 86.48
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 86.45
PRK07922169 N-acetylglutamate synthase; Validated 86.42
PRK03624140 putative acetyltransferase; Provisional 86.24
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 85.98
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 85.85
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 85.77
KOG3216|consensus163 85.47
PRK05279441 N-acetylglutamate synthase; Validated 85.28
PRK13688156 hypothetical protein; Provisional 85.18
KOG2696|consensus403 84.41
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 84.23
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 84.05
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 83.77
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 83.72
PF0476054 IF2_N: Translation initiation factor IF-2, N-termi 83.69
PRK10562145 putative acetyltransferase; Provisional 83.67
COG0456177 RimI Acetyltransferases [General function predicti 83.58
PLN02825515 amino-acid N-acetyltransferase 83.41
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 83.3
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 83.18
PF0038555 Chromo: Chromo (CHRromatin Organisation MOdifier) 83.12
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 82.86
PRK10140162 putative acetyltransferase YhhY; Provisional 82.74
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 82.68
PTZ00330147 acetyltransferase; Provisional 82.66
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 82.62
PRK13239206 alkylmercury lyase; Provisional 82.49
PF0738190 DUF1495: Winged helix DNA-binding domain (DUF1495) 82.44
PRK13688156 hypothetical protein; Provisional 82.03
PF0231971 E2F_TDP: E2F/DP family winged-helix DNA-binding do 82.01
TIGR03103547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 81.91
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 81.79
smart0041948 HTH_CRP helix_turn_helix, cAMP Regulatory protein. 81.78
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 81.52
PRK10314153 putative acyltransferase; Provisional 81.38
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 81.15
PF1354576 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 80.78
PF0208283 Rrf2: Transcriptional regulator; InterPro: IPR0009 80.7
PRK03624140 putative acetyltransferase; Provisional 80.62
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 80.62
TIGR00124332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 80.32
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 80.16
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.5e-125  Score=1018.97  Aligned_cols=371  Identities=39%  Similarity=0.710  Sum_probs=316.2

Q ss_pred             CCCeeEEEEEecCcccccccccccccccccccccchhhcc---ccc----cccccc--cccchhhhcccccccccccccc
Q psy8112          12 LENCFEYYVHYDGFNRRLDEWVQKHRIMNSRFDMSEQHWK---NKE----NQAIDL--LDQSDRKITRNQKRRHDEINHV   82 (687)
Q Consensus        12 ~~G~~eYYVHYvgfNKRLDEWVt~dRLdLs~~~~~~~~~~---~~~----~~~ss~--~~~~~rk~TR~~KRk~dEi~~~   82 (687)
                      .++.++|||||+|+||||||||+.+||+++..........   +..    ...++.  ..+..+++||+|||++++++++
T Consensus       145 ~~~~~eyYVHy~g~nrRlD~WV~~~ri~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~tr~qKR~~d~~~~~  224 (552)
T PTZ00064        145 IKEDYEFYVHFRGLNRRLDRWVKGKDIKLSFDVEELNDPNLIERFQKQGIKFISSLSVSNSANKSGNKSKKRNVGVLDIS  224 (552)
T ss_pred             cCCCeEEEEEecCcCchHhhhcChhhcccccccccccccccccccccccccccccccccccccccccccccccccccccc
Confidence            3577899999999999999999999999853211110000   000    111111  2234448999999999966544


Q ss_pred             c----cccccCCchhhhhhhhhcccccCCCccEEEEcCeeeeeccCCCCCcccCCCCcEeEecchhhccCCHHHHHHHhc
Q psy8112          83 Q----KTYEEMDPTTAALEKEHEAITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKS  158 (687)
Q Consensus        83 ~----~~~~~~d~~~~~~e~~~~~~~~~kni~~i~~G~~~i~tWY~SPyP~e~~~~~~lyiCe~Cl~y~~~~~~~~~H~~  158 (687)
                      +    .++++||+.+   .++|+++|++|||++|+||+|+|+||||||||+||++.++||||||||+||+++.+|.+|+.
T Consensus       225 ~e~~~~~~~~~d~~~---~kehee~tkvkNI~~I~~G~yei~TWYfSPYP~Ey~~~d~LYICEfCLkY~~s~~~l~rH~~  301 (552)
T PTZ00064        225 DGEDPDEHEGMDHSA---ILDHEETTRLRTIGRVRIGKFILDTWYFSPLPDEYQNVDTLHFCEYCLDFFCFEDELIRHLS  301 (552)
T ss_pred             cccCchhhccCChhh---hhcchhhhcCCCcCeEEECCeEecCCcCCCCChhhcCCCeEEEccchhhhhCCHHHHHHHHh
Confidence            2    1256677644   37899999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCcCCCCCceeeecCCceEEEEeCCcchhhHhHhhhhhhccccccccccccCcceEEEEEEEcCCCcEEEEeecccccC
Q psy8112         159 ECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKES  238 (687)
Q Consensus       159 ~C~~r~PPG~eIYr~~~~sifEVDG~~~k~yCqnLcLlaKlFLdhKtlyydv~~FlFYvl~~~d~~g~h~vGyFSKEk~s  238 (687)
                      +|.++||||+||||++++|||||||+++++|||||||||||||||||||||||||+||||||.|+.|+            
T Consensus       302 ~C~~rhPPG~EIYR~~~iSifEVDG~~~klYCQNLCLLAKLFLDhKTLYyDVdpFlFYVLtE~D~~G~------------  369 (552)
T PTZ00064        302 RCQLRHPPGNEIYRKDNISVFEIDGALTRGYAENLCYLAKLFLDHKTLQYDVEPFLFYIVTEVDEEGC------------  369 (552)
T ss_pred             cCCCCCCCCCeEEEeCCEEEEEEeCccchhHHHHHHHHHHHhccCccccccccceEEEEEEEecCCCc------------
Confidence            99999999999999999999999999999999999999999999999999999999999998775444            


Q ss_pred             CCCceeeEEEecCccccccccchhhhhhhhhhhhcCCCCCCCCCCChhhhhHHHhhhHHHHHHHhhcCCCCCCccccccc
Q psy8112         239 PDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTS  318 (687)
Q Consensus       239 ~~~~NLaCIl~lP~yQrkGyG~lLI~fSY~Ls~~eg~~G~PEkPLSdlG~~sY~sYW~~~i~~~L~~~~~~~~~~~~~~~  318 (687)
                                                                                                      
T Consensus       370 --------------------------------------------------------------------------------  369 (552)
T PTZ00064        370 --------------------------------------------------------------------------------  369 (552)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCCCcccccccCCCceeehhhhhhhcchhHHHHHHhccCcccCCCCceeeeecceeEEEecCCccchhhhhhhHHHhhhc
Q psy8112         319 SRSTRFPIECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFL  398 (687)
Q Consensus       319 ~~Sspyp~e~~~~~~~~iCe~CLKYMk~~~t~~~h~~~c~~~~PPG~eIYr~~~ls~~evdg~~~~~ycqnlcl~~klfl  398 (687)
                                                                                                      
T Consensus       370 --------------------------------------------------------------------------------  369 (552)
T PTZ00064        370 --------------------------------------------------------------------------------  369 (552)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cccceeeecCcceeEEEeeecccCccccccccCcchhhhhhhhhccccccccccccCcccccCCCCceeeeeCCeEEEEE
Q psy8112         399 DHKTLYFDVDPFLFYILCVIDKYDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEV  478 (687)
Q Consensus       399 ~~kt~~~~~~~f~fy~~~~~~~~~~~~~y~~~~~~~f~~~~~~~~~~~~~~~yf~~~~C~~~~PPG~eiYr~~~~svfEV  478 (687)
                                                                                                      
T Consensus       370 --------------------------------------------------------------------------------  369 (552)
T PTZ00064        370 --------------------------------------------------------------------------------  369 (552)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             eCCccchhhhhhhhhhhhcccccccccccCCceEEEEEEecCCCcEEEEeecccccCCCCceeEEEEecCCcccccccce
Q psy8112         479 DGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKF  558 (687)
Q Consensus       479 DG~~~k~ycqnLcLlaKlFLdhKtl~ydv~~FlFYVl~e~d~~g~h~vGyFSKEK~s~~~~NLsCIl~lP~yQrkGyG~~  558 (687)
                                                                   ||||||||||.|+++||||||||||||||||||+|
T Consensus       370 ---------------------------------------------HiVGYFSKEK~S~~~nNLACILtLPpyQRKGYGkl  404 (552)
T PTZ00064        370 ---------------------------------------------HIVGYFSKEKVSLLHYNLACILTLPCYQRKGYGKL  404 (552)
T ss_pred             ---------------------------------------------EEEEEecccccCcccCceEEEEecchhhhcchhhh
Confidence                                                         55555555555556789999999999999999999


Q ss_pred             eeecchhcccccCCCCCCCCcCChhhhhHHHhhhHHHHHHHHHcCC--------C----------CCcCHHHHHHhcCCc
Q psy8112         559 LISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSK--------G----------NSTTIKELSEMTSIA  620 (687)
Q Consensus       559 LI~fSY~Lsr~e~~~G~PEkPLSdlG~~sY~sYW~~~il~~l~~~~--------~----------~~~si~~is~~Tgi~  620 (687)
                      ||+|||+|||+||++|||||||||||++||++||+.+|+++|.+..        +          ..+||+|||++|||+
T Consensus       405 LIdfSYeLSrrEgk~GsPEKPLSDLG~lSYrsYW~~~Ile~Ll~~~~~~~~~e~~~~k~~~~~~~~~iSI~dIS~~TgI~  484 (552)
T PTZ00064        405 LVDLSYKLSLKEGKWGHPERPLSDLGRAIYNNWWAHRISEYLLEYFKQNKICERGGSKQPLQVSNYWKFIDNVVRSTGIR  484 (552)
T ss_pred             hhhhhhhhhhhcCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHhhcccccccccccccccccccCcccHHHHHHHhCCC
Confidence            9999999999999999999999999999999999999999886421        1          128999999999999


Q ss_pred             chhHHHHHHhcCcEEEeCCeEEEEeCHHHHHHHHHhhccCCCceeecCCCceEeCCCCCCCCcC
Q psy8112         621 QTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPPPKRVHSKS  684 (687)
Q Consensus       621 ~~Dii~tL~~l~~~~~~~g~~~i~~~~~~~~~~~~~~~~~~~~~~idp~~L~W~P~~~~~~~~~  684 (687)
                      ++|||.||++|||++||+|+|+|+++++++++++++.  ++++++|||++|+|+|+...++|.+
T Consensus       485 ~eDII~TLq~L~llky~kgq~~I~~~~~~ie~~~~~~--~k~~~~id~~~L~W~Py~~~~~s~~  546 (552)
T PTZ00064        485 REDVIRILEENGIMRNIKDQHYIFCNQEFLKGIVKRS--GRPGITLIDKYFNWVPFSRAPPSEV  546 (552)
T ss_pred             HHHHHHHHHHCCcEEEeCCCEEEEECHHHHHHHHHHh--cCCCceechhHceecCCCCCCCCch
Confidence            9999999999999999999999999999999999875  3567899999999999988777654

>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG2747|consensus Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>KOG2747|consensus Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>PF11717 Tudor-knot: RNA binding activity-knot of a chromodomain ; PDB: 2EKO_A 2RO0_A 2RNZ_A 1WGS_A 3E9G_A 3E9F_A 2K3X_A 2K3Y_A 2EFI_A 2F5K_F Back     alignment and domain information
>cd00024 CHROMO Chromatin organization modifier (chromo) domain is a conserved region of around 50 amino acids found in a variety of chromosomal proteins, which appear to play a role in the functional organization of the eukaryotic nucleus Back     alignment and domain information
>smart00298 CHROMO Chromatin organization modifier domain Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PF12324 HTH_15: Helix-turn-helix domain of alkylmercury lyase; InterPro: IPR024259 Alkylmercury lyase (EC:4 Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>KOG3216|consensus Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>KOG2696|consensus Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PF04760 IF2_N: Translation initiation factor IF-2, N-terminal region; InterPro: IPR006847 This region is found in the N-terminal half of translation initiation factor IF-2 Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PF00385 Chromo: Chromo (CHRromatin Organisation MOdifier) domain; InterPro: IPR023780 The CHROMO (CHRromatin Organization MOdifier) domain [, , , ] is a conserved region of around 60 amino acids, originally identified in Drosophila modifiers of variegation Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>PRK13239 alkylmercury lyase; Provisional Back     alignment and domain information
>PF07381 DUF1495: Winged helix DNA-binding domain (DUF1495); InterPro: IPR010863 This family consists of several hypothetical archaeal proteins of around 110 residues in length Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PF02319 E2F_TDP: E2F/DP family winged-helix DNA-binding domain; InterPro: IPR003316 The mammalian transcription factor E2F plays an important role in regulating the expression of genes that are required for passage through the cell cycle Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>smart00419 HTH_CRP helix_turn_helix, cAMP Regulatory protein Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF13545 HTH_Crp_2: Crp-like helix-turn-helix domain; PDB: 3LA2_A 3LA3_B 3LA7_A 3B02_A 3E97_A 2H6C_B 1OMI_A 2BGC_H 2BEO_A 2GAU_A Back     alignment and domain information
>PF02082 Rrf2: Transcriptional regulator; InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulfovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis sp Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
4dnc_A289 Crystal Structure Of Human Mof In Complex With Msl1 4e-99
3qah_A304 Crystal Structure Of Apo-Form Human Mof Catalytic D 7e-99
2pq8_A278 Myst Histone Acetyltransferase 1 Length = 278 8e-98
2giv_A295 Human Myst Histone Acetyltransferase 1 Length = 295 2e-97
2y0m_A287 Crystal Structure Of The Complex Between Dosage Com 4e-97
3tob_A270 Human Mof E350q Crystal Structure With Active Site 6e-96
3toa_A266 Human Mof Crystal Structure With Active Site Lysine 2e-92
1fy7_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 9e-69
2ou2_A280 Acetyltransferase Domain Of Human Hiv-1 Tat Interac 2e-68
3to6_A276 Crystal Structure Of Yeast Esa1 Hat Domain Complexe 4e-68
1mj9_A278 Crystal Structure Of Yeast Esa1(C304s) Mutant Compl 5e-68
1mja_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 8e-68
3to9_A276 Crystal Structure Of Yeast Esa1 E338q Hat Domain Bo 1e-67
1mjb_A278 Crystal Structure Of Yeast Esa1 Histone Acetyltrans 2e-67
2rc4_A287 Crystal Structure Of The Hat Domain Of The Human Mo 3e-66
2rc4_A287 Crystal Structure Of The Hat Domain Of The Human Mo 2e-64
2ozu_A284 Crystal Structure Of Human Myst Histone Acetyltrans 3e-65
2ozu_A284 Crystal Structure Of Human Myst Histone Acetyltrans 2e-64
1wgs_A133 Solution Structure Of The Tudor Domain From Mouse H 4e-29
2bud_A92 The Solution Structure Of The Chromo Barrel Domain 9e-05
>pdb|4DNC|A Chain A, Crystal Structure Of Human Mof In Complex With Msl1 Length = 289 Back     alignment and structure 
Iteration: 1

 Score =  358 bits (920), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 169/225 (75%), Positives = 196/225 (87%), Gaps = 1/225 (0%)
Query: 452 FSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFL 511
           F   +C +  PPGKEIYR  NIS+YEVDG  HK+YCQNLCLLAKLFLDH TLYFDV+PF+
Sbjct: 56  FHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHXTLYFDVEPFV 115
Query: 512 FYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEG 571
           FYIL  +D+ GAH+VGYFSKEKESPDGNNVACILTLPPYQR+GYGKFLI+FSYELSK+E 
Sbjct: 116 FYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLES 175
Query: 572 LIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAM 631
            +GSPEKPLSDLGKLSYRSYWSWVLL ILR+ +G + +IK+LS+MTSI Q DIISTLQ++
Sbjct: 176 TVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRG-TLSIKDLSQMTSITQNDIISTLQSL 234
Query: 632 NMVKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPP 676
           NMVKYWKGQHVICVTPK+VEEH++S QYK+P + VD   L+W PP
Sbjct: 235 NMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 279
>pdb|3QAH|A Chain A, Crystal Structure Of Apo-Form Human Mof Catalytic Domain Length = 304 Back     alignment and structure
>pdb|2PQ8|A Chain A, Myst Histone Acetyltransferase 1 Length = 278 Back     alignment and structure
>pdb|2GIV|A Chain A, Human Myst Histone Acetyltransferase 1 Length = 295 Back     alignment and structure
>pdb|2Y0M|A Chain A, Crystal Structure Of The Complex Between Dosage Compensation Factors Msl1 And Mof Length = 287 Back     alignment and structure
>pdb|1FY7|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|2OU2|A Chain A, Acetyltransferase Domain Of Human Hiv-1 Tat Interacting Protein, 60kda, Isoform 3 Length = 280 Back     alignment and structure
>pdb|3TO6|A Chain A, Crystal Structure Of Yeast Esa1 Hat Domain Complexed With H4k16coa Bisubstrate Inhibitor Length = 276 Back     alignment and structure
>pdb|1MJ9|A Chain A, Crystal Structure Of Yeast Esa1(C304s) Mutant Complexed With Coenzyme A Length = 278 Back     alignment and structure
>pdb|1MJA|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase Domain Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|3TO9|A Chain A, Crystal Structure Of Yeast Esa1 E338q Hat Domain Bound To Coenzyme A With Active Site Lysine Acetylated Length = 276 Back     alignment and structure
>pdb|1MJB|A Chain A, Crystal Structure Of Yeast Esa1 Histone Acetyltransferase E338q Mutant Complexed With Acetyl Coenzyme A Length = 278 Back     alignment and structure
>pdb|2RC4|A Chain A, Crystal Structure Of The Hat Domain Of The Human Moz Protein Length = 287 Back     alignment and structure
>pdb|2RC4|A Chain A, Crystal Structure Of The Hat Domain Of The Human Moz Protein Length = 287 Back     alignment and structure
>pdb|2OZU|A Chain A, Crystal Structure Of Human Myst Histone Acetyltransferase 3 In Complex With Acetylcoenzyme A Length = 284 Back     alignment and structure
>pdb|2OZU|A Chain A, Crystal Structure Of Human Myst Histone Acetyltransferase 3 In Complex With Acetylcoenzyme A Length = 284 Back     alignment and structure
>pdb|1WGS|A Chain A, Solution Structure Of The Tudor Domain From Mouse Hypothetical Protein Homologous To Histone Acetyltransferase Length = 133 Back     alignment and structure
>pdb|2BUD|A Chain A, The Solution Structure Of The Chromo Barrel Domain From The Males-Absent On The First (Mof) Protein Length = 92 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query687
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 1e-102
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 5e-96
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 6e-40
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 1e-100
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 1e-92
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 2e-39
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 6e-98
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 8e-96
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 1e-38
2ou2_A280 Histone acetyltransferase htatip; structural genom 1e-97
2ou2_A280 Histone acetyltransferase htatip; structural genom 1e-94
2ou2_A280 Histone acetyltransferase htatip; structural genom 1e-39
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 5e-37
2bud_A92 Males-absent on the first protein; transferase, MO 5e-14
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 1e-12
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 1e-12
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 3e-12
1bob_A320 HAT1, histone acetyltransferase; histone modificat 5e-10
1bob_A320 HAT1, histone acetyltransferase; histone modificat 4e-09
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 2e-06
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 2e-06
2lcc_A76 AT-rich interactive domain-containing protein 4A; 5e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 5e-04
3e9g_A130 Chromatin modification-related protein EAF3; chrom 7e-04
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 Back     alignment and structure
 Score =  312 bits (801), Expect = e-102
 Identities = 166/223 (74%), Positives = 195/223 (87%), Gaps = 1/223 (0%)

Query: 454 KSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFY 513
             +C +  PPGKEIYR  NIS++EVDG  HK+YCQNLCLLAKLFLDH+TLYFDV+PF+FY
Sbjct: 56  LGQCQWRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHRTLYFDVEPFVFY 115

Query: 514 ILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLI 573
           IL  +D+ GAH+VGYFSKEKESPDGNNVACILTLPPYQR+GYGKFLI+FSYELSK+E  +
Sbjct: 116 ILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTV 175

Query: 574 GSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNM 633
           GSPEKPLSDLGKLSYRSYWSWVLL  LR+ +G + +IK+LS+MTSI Q DIISTLQ++NM
Sbjct: 176 GSPEKPLSDLGKLSYRSYWSWVLLENLRDFRG-TLSIKDLSQMTSITQNDIISTLQSLNM 234

Query: 634 VKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTPP 676
           VKYWKGQHVICVTPK+VEEH++S QYK+P + VD   L+W PP
Sbjct: 235 VKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPP 277
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Length = 278 Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Length = 284 Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Length = 276 Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Length = 280 Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Length = 133 Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Length = 92 Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Length = 94 Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 320 Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Length = 320 Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Length = 324 Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Length = 324 Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Length = 102 Back     alignment and structure
>3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* Length = 130 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 100.0
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 100.0
2ou2_A280 Histone acetyltransferase htatip; structural genom 100.0
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 100.0
2ou2_A280 Histone acetyltransferase htatip; structural genom 100.0
3to7_A276 Histone acetyltransferase ESA1; MYST family; HET: 100.0
2ozu_A284 Histone acetyltransferase MYST3; structural genomi 100.0
2pq8_A278 Probable histone acetyltransferase MYST1; MOF, str 100.0
1wgs_A133 MYST histone acetyltransferase 1; tudor domain, MY 99.82
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 99.7
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 99.64
2rnz_A94 Histone acetyltransferase ESA1; HAT, chromodomain, 99.38
2eko_A87 Histone acetyltransferase htatip; chromo domain, h 99.37
2ro0_A92 Histone acetyltransferase ESA1; HAT, chromodomain, 99.36
2bud_A92 Males-absent on the first protein; transferase, MO 99.24
2lcc_A76 AT-rich interactive domain-containing protein 4A; 99.09
2lrq_A85 Protein MRG15, NUA4 complex subunit EAF3 homolog; 98.52
2f5k_A102 MORF-related gene 15 isoform 1; beta barrel, gene 98.94
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.63
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.31
3m9p_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 98.28
3m9q_A101 Protein MALE-specific lethal-3; chromodomain, MSL3 98.27
2k3y_A136 Chromatin modification-related protein EAF3; dimet 98.11
3oa6_A110 MALE-specific lethal 3 homolog; chromodomain, MSL3 97.8
3e9g_A130 Chromatin modification-related protein EAF3; chrom 97.27
3efa_A147 Putative acetyltransferase; structural genom 2, pr 95.5
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 94.73
3efa_A147 Putative acetyltransferase; structural genom 2, pr 94.53
1y7r_A133 Hypothetical protein SA2161; structural genomics, 94.46
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 94.46
3sd4_A69 PHD finger protein 20; tudor domain, transcription 94.33
2eqm_A88 PHD finger protein 20-like 1; structural genomics, 94.29
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 94.01
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 93.91
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 93.89
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 93.75
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 93.74
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 93.7
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 93.69
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 93.54
3owc_A188 Probable acetyltransferase; structural genomics, P 93.21
3mgd_A157 Predicted acetyltransferase; structural genomics, 93.21
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 92.91
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 92.89
1y7r_A133 Hypothetical protein SA2161; structural genomics, 92.88
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 92.83
1tiq_A180 Protease synthase and sporulation negative regulat 92.79
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 92.65
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 92.61
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 92.6
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 92.6
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 92.52
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 92.5
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 92.5
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 92.45
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 92.44
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 92.38
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 92.36
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 92.33
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 92.3
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 92.29
1z4r_A168 General control of amino acid synthesis protein 5- 92.29
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 92.27
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 92.25
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 92.17
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 92.11
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 92.08
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 92.08
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 92.03
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 92.01
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 91.95
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 91.88
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 91.86
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 91.84
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 91.75
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 91.67
1xeb_A150 Hypothetical protein PA0115; midwest center for st 91.64
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 91.63
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 91.62
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 91.59
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 91.53
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 91.51
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 91.47
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 91.28
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 91.27
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 91.24
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 91.19
2aj6_A159 Hypothetical protein MW0638; structural genomics, 91.11
3owc_A188 Probable acetyltransferase; structural genomics, P 91.1
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 91.02
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 90.96
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 90.86
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 90.85
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 90.82
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 90.7
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 90.6
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 90.58
1wwz_A159 Hypothetical protein PH1933; structural genomics, 90.58
2fe7_A166 Probable N-acetyltransferase; structural genomics, 90.51
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 90.5
2gan_A190 182AA long hypothetical protein; alpha-beta protei 90.49
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 90.48
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 90.42
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 90.4
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 90.4
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 90.37
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 90.34
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 90.32
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 90.3
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 90.29
3mgd_A157 Predicted acetyltransferase; structural genomics, 90.29
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 90.19
1tiq_A180 Protease synthase and sporulation negative regulat 90.16
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 90.16
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 90.15
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 90.12
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 90.11
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 90.07
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 89.9
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 89.83
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 89.82
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 89.73
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 89.64
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 89.56
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 89.54
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 89.52
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 89.5
2eui_A153 Probable acetyltransferase; dimer, structural geno 89.46
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 89.46
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 89.42
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 89.37
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 89.36
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 89.36
1vkc_A158 Putative acetyl transferase; structural genomics, 89.3
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 89.27
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 89.24
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 89.2
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 89.09
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 89.05
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 89.03
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 89.0
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 88.97
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 88.94
2fl4_A149 Spermine/spermidine acetyltransferase; structural 88.89
1xeb_A150 Hypothetical protein PA0115; midwest center for st 88.87
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 88.8
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 88.8
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 88.77
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 88.76
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 88.74
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 88.62
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 88.46
1z4r_A168 General control of amino acid synthesis protein 5- 88.39
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 88.36
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 88.35
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 88.17
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 88.15
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 88.12
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 88.09
2i6c_A160 Putative acetyltransferase; GNAT family, structura 88.06
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 88.03
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 87.98
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 87.75
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 87.74
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 87.59
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 87.58
3juw_A175 Probable GNAT-family acetyltransferase; structural 87.51
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 87.49
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 87.47
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 87.45
3frm_A254 Uncharacterized conserved protein; APC61048, staph 87.39
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 87.3
3kkw_A182 Putative uncharacterized protein; acetyltransferas 87.23
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 87.18
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 87.17
2aj6_A159 Hypothetical protein MW0638; structural genomics, 87.09
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 87.08
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 87.04
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 86.87
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 86.76
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 86.76
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 86.73
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 86.73
1wwz_A159 Hypothetical protein PH1933; structural genomics, 86.72
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 86.54
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 86.37
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 86.36
2gan_A190 182AA long hypothetical protein; alpha-beta protei 86.31
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 86.29
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 86.14
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 86.11
2fl4_A149 Spermine/spermidine acetyltransferase; structural 86.07
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 86.04
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 86.04
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 85.99
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 85.91
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 85.87
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 85.79
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 85.76
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 85.73
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 85.59
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 85.56
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 85.55
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 85.55
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 85.46
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 85.44
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 85.43
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 85.43
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 85.41
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 85.4
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 85.39
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 85.14
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 85.01
2fe7_A166 Probable N-acetyltransferase; structural genomics, 84.95
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 84.87
1nsl_A184 Probable acetyltransferase; structural genomics, h 84.76
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 84.75
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 84.72
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.67
3c26_A266 Putative acetyltransferase TA0821; NP_394282.1, A 84.65
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 84.63
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 84.55
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.36
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 84.35
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 84.73
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 84.33
2eui_A153 Probable acetyltransferase; dimer, structural geno 84.17
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 84.14
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 84.1
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 83.99
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 83.95
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.83
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 83.82
1ard_A29 Yeast transcription factor ADR1; transcription reg 83.8
1vkc_A158 Putative acetyl transferase; structural genomics, 83.75
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 83.71
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 83.68
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 83.51
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 83.47
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 83.43
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 83.39
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 83.38
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 83.34
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 83.31
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 83.06
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 83.01
3f2g_A 220 Alkylmercury lyase; MERB, organomercurial lyase, m 82.91
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 82.88
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 82.85
3frm_A254 Uncharacterized conserved protein; APC61048, staph 82.85
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 82.7
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 82.66
2i6c_A160 Putative acetyltransferase; GNAT family, structura 82.58
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 82.43
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 82.41
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 82.26
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 82.13
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 82.07
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 82.67
3juw_A175 Probable GNAT-family acetyltransferase; structural 81.84
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 81.83
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 81.82
1xmt_A103 Putative acetyltransferase; structural genomics, p 81.82
2y75_A129 HTH-type transcriptional regulator CYMR; DNA bindi 81.81
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 81.79
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 81.67
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 82.48
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 81.59
1pfb_A55 Polycomb protein; chromatin, histone methylation, 81.38
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 81.33
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 81.22
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 81.08
3kkw_A182 Putative uncharacterized protein; acetyltransferas 81.03
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 80.98
3jth_A98 Transcription activator HLYU; transcription factor 80.96
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 80.95
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 80.94
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 80.74
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 80.61
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 80.54
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 80.19
3i91_A54 Chromobox protein homolog 8; chromobox homolog 8, 80.14
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 80.12
3ddd_A288 Putative acetyltransferase; NP_142035.1, structura 80.11
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 80.1
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
Probab=100.00  E-value=3e-112  Score=866.23  Aligned_cols=276  Identities=53%  Similarity=0.980  Sum_probs=253.7

Q ss_pred             ccccCCCccEEEEcCeeeeeccCCCCCcccCCCCcEeEecchhhccCCHHHHHHHhccCCcCCCCCceeeecCCceEEEE
Q psy8112         102 AITKVKYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEV  181 (687)
Q Consensus       102 ~~~~~kni~~i~~G~~~i~tWY~SPyP~e~~~~~~lyiCe~Cl~y~~~~~~~~~H~~~C~~r~PPG~eIYr~~~~sifEV  181 (687)
                      |+|+||||++|+||+|+|+|||+||||+||++.++||||||||+||+++.+|.+|+.+|++|||||+||||++++|||||
T Consensus         1 e~tkvkni~~i~~G~~~i~tWY~SPyP~e~~~~~~lyiCe~ClkY~~~~~~~~~H~~~C~~r~PPG~eIYR~~~~svfEV   80 (276)
T 3to7_A            1 EVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEI   80 (276)
T ss_dssp             CCCCCCCCCEEEETTEEECCSSCCCCCCCCCSCCEEEECTTTCCEESSHHHHHHHHTSCCCSSCSSEEEEECSSEEEEEE
T ss_pred             CcceecccCEEEECCEEEEeeeCCCCcHHhcCCCeEEEccchhhhcCCHHHHHHHhccCCCcCCCCceEEECCCEEEEEE
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eCCcchhhHhHhhhhhhccccccccccccCcceEEEEEEEcCCCcEEEEeecccccCCCCceeeEEEecCccccccccch
Q psy8112         182 DGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKF  261 (687)
Q Consensus       182 DG~~~k~yCqnLcLlaKlFLdhKtlyydv~~FlFYvl~~~d~~g~h~vGyFSKEk~s~~~~NLaCIl~lP~yQrkGyG~l  261 (687)
                      ||+++++|||||||||||||||||||||||||+|||||+.|+.|+                                   
T Consensus        81 DG~~~k~yCQnLcLlaKLFLdhKtlyyDV~~F~FYVl~e~d~~g~-----------------------------------  125 (276)
T 3to7_A           81 DGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGH-----------------------------------  125 (276)
T ss_dssp             EGGGSHHHHHHHHHHHHTTCSCCSCTTCCTTEEEEEEEEEETTEE-----------------------------------
T ss_pred             eCCcchHHHHHHHHHHHHhhccceeeeeCCCeEEEEEEEeCCCCc-----------------------------------
Confidence            999999999999999999999999999999999999999775444                                   


Q ss_pred             hhhhhhhhhhhcCCCCCCCCCCChhhhhHHHhhhHHHHHHHhhcCCCCCCcccccccCCCCcccccccCCCceeehhhhh
Q psy8112         262 LISFSYELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGILRNSNFFPFKPVVRTSSRSTRFPIECKKKPKLWICEFCL  341 (687)
Q Consensus       262 LI~fSY~Ls~~eg~~G~PEkPLSdlG~~sY~sYW~~~i~~~L~~~~~~~~~~~~~~~~~Sspyp~e~~~~~~~~iCe~CL  341 (687)
                                                                                                      
T Consensus       126 --------------------------------------------------------------------------------  125 (276)
T 3to7_A          126 --------------------------------------------------------------------------------  125 (276)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhcchhHHHHHHhccCcccCCCCceeeeecceeEEEecCCccchhhhhhhHHHhhhccccceeeecCcceeEEEeeeccc
Q psy8112         342 KYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKY  421 (687)
Q Consensus       342 KYMk~~~t~~~h~~~c~~~~PPG~eIYr~~~ls~~evdg~~~~~ycqnlcl~~klfl~~kt~~~~~~~f~fy~~~~~~~~  421 (687)
                                                                                                      
T Consensus       126 --------------------------------------------------------------------------------  125 (276)
T 3to7_A          126 --------------------------------------------------------------------------------  125 (276)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CccccccccCcchhhhhhhhhccccccccccccCcccccCCCCceeeeeCCeEEEEEeCCccchhhhhhhhhhhhccccc
Q psy8112         422 DHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHK  501 (687)
Q Consensus       422 ~~~~~y~~~~~~~f~~~~~~~~~~~~~~~yf~~~~C~~~~PPG~eiYr~~~~svfEVDG~~~k~ycqnLcLlaKlFLdhK  501 (687)
                                                                                                      
T Consensus       126 --------------------------------------------------------------------------------  125 (276)
T 3to7_A          126 --------------------------------------------------------------------------------  125 (276)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccccCCceEEEEEEecCCCcEEEEeecccccCCCCceeEEEEecCCcccccccceeeecchhcccccCCCCCCCCcCC
Q psy8112         502 TLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLIGSPEKPLS  581 (687)
Q Consensus       502 tl~ydv~~FlFYVl~e~d~~g~h~vGyFSKEK~s~~~~NLsCIl~lP~yQrkGyG~~LI~fSY~Lsr~e~~~G~PEkPLS  581 (687)
                                            |+||||||||.|+++||||||||||||||||||+|||+|||+|||+||++||||||||
T Consensus       126 ----------------------h~vGyFSKEK~s~~~~NLaCIltlP~yQrkGyG~lLI~fSYeLSr~Eg~~G~PEkPLS  183 (276)
T 3to7_A          126 ----------------------HLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLS  183 (276)
T ss_dssp             ----------------------EEEEEEEEESSCTTCEEESCEEECGGGTTSSHHHHHHHHHHHHHHHTTCCBEECSSCC
T ss_pred             ----------------------eecccccccccccCCCeEEEEEecChHHcCCccceeehheeeeeeccCCCCCCCCCCC
Confidence                                  5555555555555668888888888888888888888888888899999999999999


Q ss_pred             hhhhhHHHhhhHHHHHHHHHcCCCCCcCHHHHHHhcCCcchhHHHHHHhcCcEEEeCCeEEEEeCHHHHHHHHHhhccCC
Q psy8112         582 DLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNMVKYWKGQHVICVTPKIVEEHIQSTQYKR  661 (687)
Q Consensus       582 dlG~~sY~sYW~~~il~~l~~~~~~~~si~~is~~Tgi~~~Dii~tL~~l~~~~~~~g~~~i~~~~~~~~~~~~~~~~~~  661 (687)
                      |||++||++||+.+|+++|.+. +..+||+|||++|||+++||++|||+|||+++|+|||+|++++++++++.+..+  +
T Consensus       184 dLG~~sY~~YW~~~i~~~L~~~-~~~isi~~is~~Tgi~~~Dii~tL~~l~~l~~~kg~~~i~~~~~~~~~~~k~~~--k  260 (276)
T 3to7_A          184 DLGLLSYRAYWSDTLITLLVEH-QKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKA--K  260 (276)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHT-CSEEEHHHHHHHHCBCHHHHHHHHHHTTCEEEETTEEEEECCHHHHHHHHHHHH--T
T ss_pred             HHHHHHHHHHHHHHHHHHHHhc-CCceeHHHHHHHhCCCHHHHHHHHHHCCCEEEeCCcEEEEECHHHHHHHHHHhc--C
Confidence            9999999999999999999876 468999999999999999999999999999999999999999999998876543  3


Q ss_pred             CceeecCCCceEeCCC
Q psy8112         662 PRLQVDPTYLRWTPPP  677 (687)
Q Consensus       662 ~~~~idp~~L~W~P~~  677 (687)
                      ++++|||++|+|+|+.
T Consensus       261 ~~~~idp~~L~W~P~~  276 (276)
T 3to7_A          261 KRRTIDPNRLIWKPPV  276 (276)
T ss_dssp             CCCCCCGGGBCCCCCC
T ss_pred             CCcEEchhhceecCCC
Confidence            4679999999999973
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>1wgs_A MYST histone acetyltransferase 1; tudor domain, MYST family, struct genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.34.13.3 Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>2rnz_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2eko_A Histone acetyltransferase htatip; chromo domain, histone tail, chromatin organization modifier, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ro0_A Histone acetyltransferase ESA1; HAT, chromodomain, tudor domain, RNA binding, activator, chromatin regulator, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2bud_A Males-absent on the first protein; transferase, MOF, HAT, acetyl-transfer, dosage compensation complex, DCC, royal family; NMR {Drosophila melanogaster} SCOP: b.34.13.3 Back     alignment and structure
>2lcc_A AT-rich interactive domain-containing protein 4A; chromobarrel domain, RBBP1, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lrq_A Protein MRG15, NUA4 complex subunit EAF3 homolog; epigenetics, LID complex, transcription; NMR {Drosophila melanogaster} Back     alignment and structure
>2f5k_A MORF-related gene 15 isoform 1; beta barrel, gene regulation; 2.20A {Homo sapiens} SCOP: b.34.13.3 PDB: 2efi_A Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3m9q_A Protein MALE-specific lethal-3; chromodomain, MSL3, methyllysine recognition, aromatic CAGE, complex, transcription upregulation; 1.29A {Drosophila melanogaster} SCOP: b.34.13.0 Back     alignment and structure
>2k3y_A Chromatin modification-related protein EAF3; dimethylated histone H3K36, EAF3-H3K36ME2 fusion, chromo barrel domain, histone deacetylase; HET: M2L; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3oa6_A MALE-specific lethal 3 homolog; chromodomain, MSL3, histone H4 tail, DNA backbone recognitio methyllysine recognition, H4K20ME1; HET: DNA MLZ; 2.35A {Homo sapiens} PDB: 3ob9_A* Back     alignment and structure
>3e9g_A Chromatin modification-related protein EAF3; chromatin remodeling, chromo domain, transcription factor, transcription regulation; 2.50A {Saccharomyces cerevisiae} PDB: 2k3x_A 3e9f_A* Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3sd4_A PHD finger protein 20; tudor domain, transcription; 1.93A {Homo sapiens} PDB: 3q1j_A Back     alignment and structure
>2eqm_A PHD finger protein 20-like 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2jtf_A Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3f2g_A Alkylmercury lyase; MERB, organomercurial lyase, mercury resistance, mercuric resistance, plasmid; 1.78A {Escherichia coli} PDB: 3f2h_A 3fn8_A 1s6l_A 3f0o_A 3f0p_A 3f2f_A Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>2y75_A HTH-type transcriptional regulator CYMR; DNA binding protein; 2.00A {Bacillus subtilis} Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>1pfb_A Polycomb protein; chromatin, histone methylation, polycomb, chromodomain, peptide binding protein; HET: M3L; 1.40A {Drosophila melanogaster} SCOP: b.34.13.2 Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>3i91_A Chromobox protein homolog 8; chromobox homolog 8, CBX8, structural genomics structural genomics consortium, SGC, chromatin regulator, N phosphoprotein, repressor; HET: M3L; 1.55A {Homo sapiens} SCOP: b.34.13.2 PDB: 3gv6_A* 3i90_A* Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 687
d2giva1271 d.108.1.1 (A:4-274) Probable histone acetyltransfe 1e-113
d2giva1271 d.108.1.1 (A:4-274) Probable histone acetyltransfe 1e-108
d2giva1271 d.108.1.1 (A:4-274) Probable histone acetyltransfe 5e-45
d2ozua1270 d.108.1.1 (A:507-776) Histone acetyltransferase MY 1e-109
d2ozua1270 d.108.1.1 (A:507-776) Histone acetyltransferase MY 1e-103
d2ozua1270 d.108.1.1 (A:507-776) Histone acetyltransferase MY 2e-43
d1fy7a_273 d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak 1e-108
d1fy7a_273 d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak 1e-107
d1fy7a_273 d.108.1.1 (A:) Histone acetyltransferase ESA1 {Bak 4e-44
d1wgsa_133 b.34.13.3 (A:) Probable histone acetyltransferase 6e-39
d1boba_315 d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak 7e-26
d1boba_315 d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak 2e-25
d1boba_315 d.108.1.1 (A:) Histone acetyltransferase HAT1 {Bak 2e-07
d2buda188 b.34.13.3 (A:367-454) Putative histone acetyltrans 4e-14
d1m36a_33 g.37.1.2 (A:) Monocytic leukemia zinc finger prote 4e-08
d1m36a_33 g.37.1.2 (A:) Monocytic leukemia zinc finger prote 4e-08
d2f5ka183 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1e-04
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Probable histone acetyltransferase MYST1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  338 bits (869), Expect = e-113
 Identities = 166/222 (74%), Positives = 194/222 (87%), Gaps = 1/222 (0%)

Query: 454 KSECTYCHPPGKEIYRCGNISIYEVDGSFHKLYCQNLCLLAKLFLDHKTLYFDVDPFLFY 513
             +C +  PPGKEIYR  NIS++EVDG  HK+YCQNLCLLAKLFLDHKTLYFDV+PF+FY
Sbjct: 51  LGQCQWRQPPGKEIYRKSNISVHEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFY 110

Query: 514 ILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFSYELSKVEGLI 573
           IL  +D+ GAH+VGYFSKEKESPDGNNVACILTLPPYQR+GYGKFLI+FSYELSK+E  +
Sbjct: 111 ILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTV 170

Query: 574 GSPEKPLSDLGKLSYRSYWSWVLLGILRNSKGNSTTIKELSEMTSIAQTDIISTLQAMNM 633
           GSPEKPLSDLGKLSYRSYWSWVLL  LR+ +G + +IK+LS+MTSI Q DIISTLQ++NM
Sbjct: 171 GSPEKPLSDLGKLSYRSYWSWVLLENLRDFRG-TLSIKDLSQMTSITQNDIISTLQSLNM 229

Query: 634 VKYWKGQHVICVTPKIVEEHIQSTQYKRPRLQVDPTYLRWTP 675
           VKYWKGQHVICVTPK+VEEH++S QYK+P + VD   L+W P
Sbjct: 230 VKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAP 271
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 273 Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 133 Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 315 Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query687
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 100.0
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 100.0
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 100.0
d2giva1271 Probable histone acetyltransferase MYST1 {Human (H 100.0
d1fy7a_273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 100.0
d2ozua1270 Histone acetyltransferase MYST3 {Human (Homo sapie 100.0
d1wgsa_133 Probable histone acetyltransferase MYST1 {Mouse (M 99.82
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 99.71
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 99.7
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 99.26
d2buda188 Putative histone acetyltransferase MOF {Fruit fly 99.12
d1m36a_33 Monocytic leukemia zinc finger protein Moz {Human 98.98
d2f5ka183 Mortality factor 4-like protein 1, MRG15 {Human (H 98.43
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 95.12
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 94.73
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 94.43
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 94.15
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 94.11
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 93.82
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 93.81
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 93.54
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 93.32
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 93.26
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 93.18
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 93.09
d1tiqa_173 Protease synthase and sporulation negative regulat 93.08
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 92.98
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 92.73
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 92.61
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 92.47
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 92.31
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 92.21
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 92.13
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 92.02
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 91.88
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 91.75
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 91.74
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 91.64
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 91.63
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 91.47
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 91.43
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 90.82
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 90.78
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 90.61
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 90.55
d1tiqa_173 Protease synthase and sporulation negative regulat 90.55
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 90.4
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 90.34
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 90.16
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 89.94
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 89.76
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 89.75
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 89.66
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 89.6
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 89.57
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 89.49
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 89.24
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 89.2
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 89.19
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 89.1
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 89.03
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 88.95
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 88.78
d1mkma175 Transcriptional regulator IclR, N-terminal domain 88.69
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 88.68
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 88.52
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 88.34
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 88.08
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 88.05
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 87.9
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 87.86
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 87.56
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 87.25
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 87.25
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 87.07
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 87.07
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 87.07
d1pfba_55 Polycomb protein, Pc {Fruit fly (Drosophila melano 86.75
d2dnta166 Chromodomain protein, Y-like isoform {Human (Homo 86.66
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 86.22
d1q3la_52 Heterochromatin protein 1, HP1 {Fruit fly (Drosoph 86.2
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 85.97
d1l0oc_57 SigmaF {Bacillus stearothermophilus [TaxId: 1422]} 85.94
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 85.63
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 85.59
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 85.57
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 85.23
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 84.92
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 84.86
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 84.74
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 84.55
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 84.45
d2dnva152 Chromobox protein homolog 8 {Mouse (Mus musculus) 84.35
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 84.13
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 83.95
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 83.93
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 83.78
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 83.62
d2cota238 Zinc finger and SCAN domain-containing protein 16, 83.57
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 83.55
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 83.2
d1s6la160 Alkylmercury lyase MerB {Escherichia coli [TaxId: 83.03
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 82.89
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 82.63
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 81.96
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 81.85
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 81.01
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 80.8
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 80.56
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Acyl-CoA N-acyltransferases (Nat)
superfamily: Acyl-CoA N-acyltransferases (Nat)
family: N-acetyl transferase, NAT
domain: Probable histone acetyltransferase MYST1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=9e-109  Score=838.27  Aligned_cols=197  Identities=76%  Similarity=1.408  Sum_probs=195.0

Q ss_pred             CCccEEEEcCeeeeeccCCCCCcccCCCCcEeEecchhhccCCHHHHHHHhccCCcCCCCCceeeecCCceEEEEeCCcc
Q psy8112         107 KYIDKIMIGKCEIDTWYFSPYPDECKKKPKLWICEFCLKYMTMERTYRYHKSECTYCHPPGKEIYRCGNISIYEVDGSFH  186 (687)
Q Consensus       107 kni~~i~~G~~~i~tWY~SPyP~e~~~~~~lyiCe~Cl~y~~~~~~~~~H~~~C~~r~PPG~eIYr~~~~sifEVDG~~~  186 (687)
                      |||++|+||+|+|+|||+||||+|+++.++||||||||+||+++.+|.+|+++|.++||||+||||++++|||||||+++
T Consensus         1 k~I~~i~~G~y~~~tWY~SPyP~e~~~~~~lyiCe~Cl~y~~~~~~~~~H~~~C~~~~PPG~eIYr~~~~si~EVDG~~~   80 (271)
T d2giva1           1 KYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVHEVDGKDH   80 (271)
T ss_dssp             CCCCEEEETTEEEECSSCCCCCGGGCSSSEEEECTTTCCEESSHHHHHHHHHHCCCCSCSSEEEEEETTEEEEEEETTTS
T ss_pred             CCCCEEEECCEEEcCCcCCCCchHhcCCCeEEECcCcCcccCCHHHHHHHHHhCCCcCCCcceEeecCCEEEEEeeCccc
Confidence            79999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhHhHhhhhhhccccccccccccCcceEEEEEEEcCCCcEEEEeecccccCCCCceeeEEEecCccccccccchhhhhh
Q psy8112         187 KLYCQNLCLLAKLFLDHKTLYFDVDPFLFYILCVIDKYGAHLVGYFSKEKESPDGNNVACILTLPPYQRQGYGKFLISFS  266 (687)
Q Consensus       187 k~yCqnLcLlaKlFLdhKtlyydv~~FlFYvl~~~d~~g~h~vGyFSKEk~s~~~~NLaCIl~lP~yQrkGyG~lLI~fS  266 (687)
                      ++|||||||||||||||||||||||||+|||||+.|++|+|+||||||||.|+++||||||||||||||||||+|||+||
T Consensus        81 ~~yCqnLcLlaKLFLdhKtl~ydV~~F~FYVl~e~d~~g~h~vGYFSKEk~s~~~~NLsCIltlP~yQrkGyG~lLI~fS  160 (271)
T d2giva1          81 KIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFS  160 (271)
T ss_dssp             HHHHHHHHHHHHTTCSCCSCTTCCTTEEEEEEEEECSSCEEEEEEEEEESSCTTCEEESCEEECGGGCSSSHHHHHHHHH
T ss_pred             hhhhhHHHHHHHHhcccceeeecCCceEEEEEEEecCCCceEEEeeeeEeccCCCceeeeeeccCHHHhcCHhHhHHhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhhhcCCCCCCCCCCChhhhhHHHhhhHHHHHHHh
Q psy8112         267 YELSKVEGLIGSPEKPLSDLGKLSYRSYWSWVLLGIL  303 (687)
Q Consensus       267 Y~Ls~~eg~~G~PEkPLSdlG~~sY~sYW~~~i~~~L  303 (687)
                      |+|||+||++|||||||||||+++|++||+++|+++|
T Consensus       161 YeLSr~E~~~G~PEkPLSdLG~~sY~~YW~~~il~~l  197 (271)
T d2giva1         161 YELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLENL  197 (271)
T ss_dssp             HHHHHHTTCCBEECSSCCHHHHHHHHHHHHHHHHHHH
T ss_pred             hhhhhccCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999999998877
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgsa_ b.34.13.3 (A:) Probable histone acetyltransferase MYST1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2buda1 b.34.13.3 (A:367-454) Putative histone acetyltransferase MOF {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1m36a_ g.37.1.2 (A:) Monocytic leukemia zinc finger protein Moz {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ka1 b.34.13.3 (A:6-88) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1pfba_ b.34.13.2 (A:) Polycomb protein, Pc {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2dnta1 b.34.13.2 (A:8-73) Chromodomain protein, Y-like isoform {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1q3la_ b.34.13.2 (A:) Heterochromatin protein 1, HP1 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l0oc_ a.4.13.2 (C:) SigmaF {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dnva1 b.34.13.2 (A:7-58) Chromobox protein homolog 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6la1 a.4.5.79 (A:21-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure