Diaphorina citri psyllid: psy8137


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MDPGPNTPPTATPPELFCHSLHFPKGMLLRWFNNLYNLEIIEEEAFSKWRENISDAYPGKGEALFQVNAWLNWLAEAESEEEEEEEEN
ccccccccccHHHHHHHHHcccccHHHHHHHHHHHHccccccccHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHccc
*****NT*PTATPPELFCHSLHFPKGMLLRWFNNLYNLEIIEEEAFSKWRENISDAYPGKGEALFQVNAWLNWLA*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPGPNTPPTATPPELFCHSLHFPKGMLLRWFNNLYNLEIIEEEAFSKWRENISDAYPGKGEALFQVNAWLNWLAEAESEEEEEEEEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic translation initiation factor 4 gamma 2 Appears to play a role in the switch from cap-dependent to IRES-mediated translation during mitosis, apoptosis and viral infection. Cleaved by some caspases and viral proteases.confidentQ95L46
Eukaryotic translation initiation factor 4 gamma 2 Appears to play a role in the switch from cap-dependent to IRES-mediated translation during mitosis, apoptosis and viral infection. Cleaved by some caspases and viral proteases.confidentP79398
Eukaryotic translation initiation factor 4 gamma 2 Appears to play a role in the switch from cap-dependent to IRES-mediated translation during mitosis, apoptosis and viral infection. Cleaved by some caspases and viral proteases.confidentQ5R7J9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3D3M, chain A
Confidence level:very confident
Coverage over the Query: 5-77
View the alignment between query and template
View the model in PyMOL