Diaphorina citri psyllid: psy8157


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MTSKTDVELGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKTR
cccccccccccccccccccccccccccccccccccEEEccccEEEEEEcccccccccHHHHHHHHHHHHccccEEEEcccccEEEEEEcccccccCEEEEEEcccccccHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHccccccccccEEEEEcccccEECccHHHHHHHHccccccc
***KTD**LGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSKTDVELGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031957 [MF]very long-chain fatty acid-CoA ligase activityprobableGO:0003824, GO:0003674, GO:0015645, GO:0016874, GO:0016877
GO:0031224 [CC]intrinsic to membraneprobableGO:0005575, GO:0044425, GO:0016020
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0015908 [BP]fatty acid transportprobableGO:0051234, GO:0015718, GO:0006869, GO:0015849, GO:0006811, GO:0006810, GO:0015711, GO:0051179, GO:0044765, GO:0008150, GO:0071702, GO:0033036, GO:0010876, GO:0006820, GO:0044699, GO:0046942
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0000038 [BP]very long-chain fatty acid metabolic processprobableGO:0044238, GO:0006631, GO:0006629, GO:0006082, GO:0009987, GO:0044710, GO:0044237, GO:0032787, GO:0071704, GO:0008150, GO:0019752, GO:0008152, GO:0043436, GO:0044255, GO:0044281
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3G7S, chain A
Confidence level:confident
Coverage over the Query: 9-44,55-137
View the alignment between query and template
View the model in PyMOL