Psyllid ID: psy8157

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MTSKTDVELGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKTR
cccccccccccccccccccccccccccccccccccEEEccccEEEEEEcccccccccHHHHHHHHHHHHccccEEEEcccccEEEEEEcccccccEEEEEEEcccccccHHHHHHHHHHcccccccccEEEEEcccccccccHHHHHHHHHccccccccccEEEEEcccccEEEccHHHHHHHHccccccc
ccccccEEEccHHHHHHHHHHcccccEEEccccEEEEEccccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEEEcccccccccEEEEEcccccccHHHHHHHHHHHccHcccHHHEEHHHHHcccccHHHHHHHHHHcccccccccccEEEEcccccEccccHHHHHHHHccccccc
mtsktdvelgfpkvtkpkhdsstlndkppkkASINLLKALQRYLRFLWAARRVAQKDLTIADIFRehavrspnkVIFMFENTewtaqqvpgyegragMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMtgtyklkkldlqkegfdpnviQDRLYYLsskgvyeeltPEVYKDLVQEFWKTR
mtsktdvelgfpkvtkpkhdsstlndkppkkASINLLKALQRYLRFLWAARRVAQKDLTIADifrehavrspNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIkkalpsyarplFIRCLREVEMTGTyklkkldlqkegfdpnvIQDRLYYLSSkgvyeeltpeVYKDLVQEFWKTR
MTSKTDVELGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKTR
*********************************INLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFW***
***KTD**LGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKT*
MTSKTDVELGFPKVT***********KPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKTR
****TDVELGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQE*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSKTDVELGFPKVTKPKHDSSTLNDKPPKKASINLLKALQRYLRFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQEFWKTR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q91VE0643 Long-chain fatty acid tra yes N/A 0.486 0.144 0.5 5e-20
Q4R3Y4643 Long-chain fatty acid tra N/A N/A 0.486 0.144 0.5 2e-19
Q5RDY4643 Long-chain fatty acid tra yes N/A 0.486 0.144 0.489 8e-19
Q6P1M0643 Long-chain fatty acid tra yes N/A 0.486 0.144 0.489 8e-19
Q6PCB7646 Long-chain fatty acid tra no N/A 0.481 0.142 0.494 5e-18
Q60714646 Long-chain fatty acid tra no N/A 0.502 0.148 0.474 7e-18
P97849646 Long-chain fatty acid tra no N/A 0.502 0.148 0.453 5e-17
Q3ZKN0646 Long-chain fatty acid tra no N/A 0.502 0.148 0.474 3e-16
Q9ES38690 Bile acyl-CoA synthetase no N/A 0.528 0.146 0.436 9e-16
P97524620 Very long-chain acyl-CoA no N/A 0.696 0.214 0.328 3e-15
>sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 Back     alignment and function desciption
 Score = 97.4 bits (241), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 67/94 (71%), Gaps = 1/94 (1%)

Query: 88  QVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKL 147
           +VPG EGRAGMAA+     + D+ + ++ +KK LP YARP+F+R L E+  TGT+K +K 
Sbjct: 540 EVPGTEGRAGMAAVASPISNCDLESFAQTLKKELPLYARPIFLRFLPELHKTGTFKFQKT 599

Query: 148 DLQKEGFDPNVIQDRLYYLSS-KGVYEELTPEVY 180
           +L+KEGFDP+V++D L+YL + KG Y  L  E Y
Sbjct: 600 ELRKEGFDPSVVKDPLFYLDARKGCYVALDQEAY 633
Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=1 Back     alignment and function description
>sp|Q5RDY4|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1 Back     alignment and function description
>sp|Q6P1M0|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1 Back     alignment and function description
>sp|Q6PCB7|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 Back     alignment and function description
>sp|Q60714|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 Back     alignment and function description
>sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ES38|S27A5_RAT Bile acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a5 PE=1 SV=1 Back     alignment and function description
>sp|P97524|S27A2_RAT Very long-chain acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
328696706 737 PREDICTED: long-chain fatty acid transpo 0.507 0.131 0.653 3e-30
328696708 624 PREDICTED: long-chain fatty acid transpo 0.507 0.155 0.653 3e-30
340722519 649 PREDICTED: long-chain fatty acid transpo 0.513 0.151 0.602 1e-29
383858393 603 PREDICTED: long-chain fatty acid transpo 0.507 0.160 0.608 2e-29
380012084 648 PREDICTED: LOW QUALITY PROTEIN: long-cha 0.513 0.151 0.571 4e-29
350418493 649 PREDICTED: long-chain fatty acid transpo 0.476 0.140 0.591 4e-29
328782992 648 PREDICTED: long-chain fatty acid transpo 0.476 0.140 0.571 4e-29
170041869 627 long-chain fatty acid transport protein 0.539 0.164 0.561 4e-28
345493603 649 PREDICTED: long-chain fatty acid transpo 0.513 0.151 0.542 5e-28
312385826 621 hypothetical protein AND_00299 [Anophele 0.549 0.169 0.571 7e-28
>gi|328696706|ref|XP_001942878.2| PREDICTED: long-chain fatty acid transport protein 4-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  137 bits (344), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 83/98 (84%)

Query: 88  QVPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKL 147
           +VP  EGRAGMAAI+D + +LDV+ +S+G++KALPSYARPLFIR L EVEMTGTYKLKKL
Sbjct: 635 EVPNSEGRAGMAAIVDKDNTLDVSTLSDGLQKALPSYARPLFIRKLNEVEMTGTYKLKKL 694

Query: 148 DLQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQ 185
           DLQ++G+D   I+D++YY +SKG+Y+ELT E Y D+V 
Sbjct: 695 DLQRDGYDIGRIKDQVYYSNSKGIYQELTIEAYTDIVS 732

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328696708|ref|XP_003240103.1| PREDICTED: long-chain fatty acid transport protein 4-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340722519|ref|XP_003399652.1| PREDICTED: long-chain fatty acid transport protein 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|383858393|ref|XP_003704686.1| PREDICTED: long-chain fatty acid transport protein 4-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380012084|ref|XP_003690119.1| PREDICTED: LOW QUALITY PROTEIN: long-chain fatty acid transport protein 4-like [Apis florea] Back     alignment and taxonomy information
>gi|350418493|ref|XP_003491875.1| PREDICTED: long-chain fatty acid transport protein 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328782992|ref|XP_392108.3| PREDICTED: long-chain fatty acid transport protein 4-like [Apis mellifera] Back     alignment and taxonomy information
>gi|170041869|ref|XP_001848670.1| long-chain fatty acid transport protein 4 [Culex quinquefasciatus] gi|167865464|gb|EDS28847.1| long-chain fatty acid transport protein 4 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|345493603|ref|XP_003427107.1| PREDICTED: long-chain fatty acid transport protein 4-like isoform 2 [Nasonia vitripennis] gi|345493605|ref|XP_001603871.2| PREDICTED: long-chain fatty acid transport protein 4-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|312385826|gb|EFR30231.1| hypothetical protein AND_00299 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
FB|FBgn0021953705 Fatp "Fatty acid (long chain) 0.502 0.136 0.587 2.6e-26
UNIPROTKB|E1BT18654 SLC27A4 "Uncharacterized prote 0.507 0.148 0.474 1.5e-25
UNIPROTKB|Q0VCQ2643 SLC27A4 "Solute carrier family 0.486 0.144 0.521 7.3e-25
ZFIN|ZDB-GENE-050417-248643 slc27a4 "solute carrier family 0.507 0.150 0.5 7.6e-25
UNIPROTKB|G3V7V3643 Slc27a4 "Solute carrier family 0.486 0.144 0.489 2e-24
MGI|MGI:1347347643 Slc27a4 "solute carrier family 0.486 0.144 0.5 4.2e-24
UNIPROTKB|J9P1R3701 SLC27A4 "Uncharacterized prote 0.486 0.132 0.489 1.1e-22
ZFIN|ZDB-GENE-061013-672648 slc27a1b "solute carrier famil 0.507 0.149 0.510 6.3e-22
ZFIN|ZDB-GENE-050320-112647 slc27a1a "solute carrier famil 0.507 0.149 0.448 1.3e-21
FB|FBgn0034999687 CG3394 [Drosophila melanogaste 0.492 0.136 0.457 3.2e-21
FB|FBgn0021953 Fatp "Fatty acid (long chain) transport protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 291 (107.5 bits), Expect = 2.6e-26, Sum P(2) = 2.6e-26
 Identities = 57/97 (58%), Positives = 73/97 (75%)

Query:    89 VPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLD 148
             +P  EGRAGMAAI D  + LD+   +  + K LP+YARP  IR L +V++TGT+KL+K+D
Sbjct:   604 IPHTEGRAGMAAIYDPERELDLDVFAASLAKVLPAYARPQIIRLLTKVDLTGTFKLRKVD 663

Query:   149 LQKEGFDPNVIQDRLYYLSSKGVYEELTPEVYKDLVQ 185
             LQKEG+DPN I+D LYY +SKG YE LTP+VY D VQ
Sbjct:   664 LQKEGYDPNAIKDALYYQTSKGRYELLTPQVY-DQVQ 699
GO:0005324 "long-chain fatty acid transporter activity" evidence=ISS
GO:0015909 "long-chain fatty acid transport" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0070328 "triglyceride homeostasis" evidence=IMP
UNIPROTKB|E1BT18 SLC27A4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCQ2 SLC27A4 "Solute carrier family 27 (Fatty acid transporter), member 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-248 slc27a4 "solute carrier family 27 (fatty acid transporter), member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3V7V3 Slc27a4 "Solute carrier family 27 (Fatty acid transporter), member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1347347 Slc27a4 "solute carrier family 27 (fatty acid transporter), member 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1R3 SLC27A4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-061013-672 slc27a1b "solute carrier family 27 (fatty acid transporter), member 1b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050320-112 slc27a1a "solute carrier family 27 (fatty acid transporter), member 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0034999 CG3394 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
PRK08279600 PRK08279, PRK08279, long-chain-acyl-CoA synthetase 4e-34
cd05939474 cd05939, hsFATP4_like, Fatty acid transport protei 3e-26
cd05938535 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport 2e-23
cd05940444 cd05940, FATP_FACS, Fatty acid transport proteins 4e-23
cd05937468 cd05937, FATP_chFAT1_like, Uncharacterized subfami 2e-13
PRK08279 600 PRK08279, PRK08279, long-chain-acyl-CoA synthetase 0.004
>gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information 
 Score =  126 bits (318), Expect = 4e-34
 Identities = 47/98 (47%), Positives = 67/98 (68%), Gaps = 2/98 (2%)

Query: 88  QVPGYEGRAGMAAI-LDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKK 146
           +VPG +GRAGMAAI L      D+ A++  + + LP+YA PLF+R + E+E TGT+K +K
Sbjct: 496 EVPGTDGRAGMAAIVLADGAEFDLAALAAHLYERLPAYAVPLFVRLVPELETTGTFKYRK 555

Query: 147 LDLQKEGFDPNVIQDRLYYLSSK-GVYEELTPEVYKDL 183
           +DL+KEGFDP+ + D LY L    G Y  LT E+Y ++
Sbjct: 556 VDLRKEGFDPSKVDDPLYVLDPGSGGYVPLTAELYAEI 593

Length = 600
>gnl|CDD|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins Back     alignment and domain information
>gnl|CDD|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins Back     alignment and domain information
>gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes Back     alignment and domain information
>gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi Back     alignment and domain information
>gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG1179|consensus649 99.94
PRK08279600 long-chain-acyl-CoA synthetase; Validated 99.9
KOG1176|consensus537 99.9
PRK07868994 acyl-CoA synthetase; Validated 99.85
PRK13388540 acyl-CoA synthetase; Provisional 99.83
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 99.83
PRK07867529 acyl-CoA synthetase; Validated 99.81
KOG1177|consensus596 99.76
PLN02654666 acetate-CoA ligase 99.72
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 99.72
PLN03102579 acyl-activating enzyme; Provisional 99.7
PLN03051499 acyl-activating enzyme; Provisional 99.7
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 99.69
PTZ00237647 acetyl-CoA synthetase; Provisional 99.69
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 99.69
PRK07788549 acyl-CoA synthetase; Validated 99.69
PRK07529632 AMP-binding domain protein; Validated 99.69
PRK03584655 acetoacetyl-CoA synthetase; Provisional 99.69
PLN02574560 4-coumarate--CoA ligase-like 99.69
PRK04319570 acetyl-CoA synthetase; Provisional 99.68
PRK09188365 serine/threonine protein kinase; Provisional 99.68
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 99.68
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 99.68
PRK05852534 acyl-CoA synthetase; Validated 99.67
PRK00174637 acetyl-CoA synthetase; Provisional 99.67
PRK06839496 acyl-CoA synthetase; Validated 99.66
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 99.66
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 99.66
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 99.65
PLN02860563 o-succinylbenzoate-CoA ligase 99.65
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 99.63
PRK07769631 long-chain-fatty-acid--CoA ligase; Validated 99.63
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 99.62
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 99.62
PRK07470528 acyl-CoA synthetase; Validated 99.61
PRK06060 705 acyl-CoA synthetase; Validated 99.61
PLN02246537 4-coumarate--CoA ligase 99.61
PRK13390501 acyl-CoA synthetase; Provisional 99.61
PRK06145497 acyl-CoA synthetase; Validated 99.61
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 99.61
PRK09088488 acyl-CoA synthetase; Validated 99.61
PRK13382537 acyl-CoA synthetase; Provisional 99.61
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 99.61
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 99.61
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 99.6
PRK06178567 acyl-CoA synthetase; Validated 99.6
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 99.59
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 99.59
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 99.59
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 99.59
PRK05857540 acyl-CoA synthetase; Validated 99.58
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 99.58
PLN02330546 4-coumarate--CoA ligase-like 1 99.58
PRK08162545 acyl-CoA synthetase; Validated 99.58
PRK12583558 acyl-CoA synthetase; Provisional 99.58
PRK06188524 acyl-CoA synthetase; Validated 99.58
PRK10524629 prpE propionyl-CoA synthetase; Provisional 99.57
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 99.57
PRK07638487 acyl-CoA synthetase; Validated 99.57
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 99.57
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 99.57
PRK08315559 AMP-binding domain protein; Validated 99.57
PRK07798533 acyl-CoA synthetase; Validated 99.57
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 99.55
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 99.55
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 99.55
PRK09274552 peptide synthase; Provisional 99.55
KOG1175|consensus626 99.55
PRK07787471 acyl-CoA synthetase; Validated 99.55
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 99.54
PRK10946536 entE enterobactin synthase subunit E; Provisional 99.54
PRK07514504 malonyl-CoA synthase; Validated 99.53
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 99.53
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.53
PLN02479567 acetate-CoA ligase 99.53
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 99.53
PRK06164540 acyl-CoA synthetase; Validated 99.52
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 99.52
PRK06018542 putative acyl-CoA synthetase; Provisional 99.52
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 99.52
PRK08316523 acyl-CoA synthetase; Validated 99.51
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 99.51
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 99.51
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.51
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 99.51
PLN03052728 acetate--CoA ligase; Provisional 99.5
PRK12476612 putative fatty-acid--CoA ligase; Provisional 99.49
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 99.49
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 99.49
PRK13391511 acyl-CoA synthetase; Provisional 99.49
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 99.46
PRK06087547 short chain acyl-CoA synthetase; Reviewed 99.46
PRK12467 3956 peptide synthase; Provisional 99.45
PRK12316 5163 peptide synthase; Provisional 99.45
PRK13383516 acyl-CoA synthetase; Provisional 99.44
PRK12316 5163 peptide synthase; Provisional 99.44
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 99.44
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 99.44
PRK08308414 acyl-CoA synthetase; Validated 99.43
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 99.42
PLN02736651 long-chain acyl-CoA synthetase 99.42
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.41
PRK09192579 acyl-CoA synthetase; Validated 99.4
PRK05691 4334 peptide synthase; Validated 99.34
PRK05691 4334 peptide synthase; Validated 99.32
PRK12467 3956 peptide synthase; Provisional 99.31
PRK05850578 acyl-CoA synthetase; Validated 99.28
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.22
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.17
PRK08180614 feruloyl-CoA synthase; Reviewed 99.13
PLN02861660 long-chain-fatty-acid-CoA ligase 99.08
PLN02614666 long-chain acyl-CoA synthetase 98.95
PRK12582624 acyl-CoA synthetase; Provisional 98.89
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 98.89
PLN02430660 long-chain-fatty-acid-CoA ligase 98.78
KOG1178|consensus 1032 98.69
PTZ00342746 acyl-CoA synthetase; Provisional 98.64
PTZ00216700 acyl-CoA synthetase; Provisional 98.39
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 97.69
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 96.42
KOG1256|consensus691 95.07
PTZ00297 1452 pantothenate kinase; Provisional 94.13
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 92.9
PF1453596 AMP-binding_C_2: AMP-binding enzyme C-terminal dom 91.88
KOG1180|consensus678 89.13
KOG1179|consensus 649 82.4
>KOG1179|consensus Back     alignment and domain information 
Probab=99.94  E-value=3.4e-27  Score=218.50  Aligned_cols=134  Identities=41%  Similarity=0.719  Sum_probs=126.5

Q ss_pred             eEEeceeeeeccCcchHHHHHHHHHhCCCcccceeeeEEEEEEecCCCCCceEEEEEE-cCCCCCCHHHHHHHHHhcCCC
Q psy8157          45 RFLWAARRVAQKDLTIADIFREHAVRSPNKVIFMFENTEWTAQQVPGYEGRAGMAAIL-DINKSLDVTAVSEGIKKALPS  123 (191)
Q Consensus        45 ~i~~~g~nv~~~e~~Ve~~~e~~l~~hP~k~~~~V~eaaVvGVpd~~~~ge~~~A~Vv-~~g~~~~~e~l~~~l~~~Lp~  123 (191)
                      +|+|+||||+++|  ||+++    ....+     ++||.||||..|.++|+++||+|+ .|+...+.+.+.+++++.||+
T Consensus       513 TFRWKGENVsTtE--Ve~~l----~~~~~-----~~dv~VYGV~VP~~EGRaGMAaI~~~p~~~~d~~~l~~~l~~~LP~  581 (649)
T KOG1179|consen  513 TFRWKGENVSTTE--VEDVL----SALDF-----LQDVNVYGVTVPGYEGRAGMAAIVLDPTTEKDLEKLYQHLRENLPS  581 (649)
T ss_pred             ceeecCCcccHHH--HHHHH----hhhcc-----ccceeEEEEecCCccCccceEEEEecCcccchHHHHHHHHHhhCcc
Confidence            6799999999999  97655    56677     999999999999999999999999 999999999999999999999


Q ss_pred             CCcccEEEEeccCCCCCCCCcchHHHhhccCCCCCcCCeeEEEc-CCCceeeCCHHHHHHHhccccc
Q psy8157         124 YARPLFIRCLREVEMTGTYKLKKLDLQKEGFDPNVIQDRLYYLS-SKGVYEELTPEVYKDLVQEFWK  189 (191)
Q Consensus       124 ykvP~~v~~v~eLP~T~tGKi~K~~Lr~~~~~~~~~~d~vy~l~-~~~~Y~~lt~~~~~~i~~g~~~  189 (191)
                      |++|+|+++++++++|+|.|.+|.+|+++|+++...+|++|+++ ..++|+|||++.+++|..|.++
T Consensus       582 YA~P~FlRl~~~i~~TgTFKl~K~~L~~egf~p~~~~dply~~~~~~~~y~Plt~~~y~~i~~g~~~  648 (649)
T KOG1179|consen  582 YARPRFLRLQDEIEKTGTFKLQKTELQKEGFNPAIISDPLYYLDNAGKSYVPLTQEMYSAISAGELK  648 (649)
T ss_pred             ccchHHHHHHhhhhcccchhhHHHHHHHccCCccccCCceEEEeccCCccccCCHHHHHHHhcCccC
Confidence            99999999999999999999999999999999999999999999 5567999999999999999876

>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1176|consensus Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B Back     alignment and domain information
>KOG1180|consensus Back     alignment and domain information
>KOG1179|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 99.82
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 99.82
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 99.81
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 99.81
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 99.81
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 99.8
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 99.79
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 99.79
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 99.78
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 99.77
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.76
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 99.76
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 99.75
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 99.75
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 99.75
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.75
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 99.74
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.73
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 99.73
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 99.73
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 99.72
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 99.72
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 99.69
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 99.69
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 99.68
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.67
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 99.66
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 99.59
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 99.57
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 99.49
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 99.46
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 99.43
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 99.34
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.28
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.26
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.21
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
Probab=99.82  E-value=4.2e-21  Score=173.10  Aligned_cols=131  Identities=11%  Similarity=0.086  Sum_probs=110.9

Q ss_pred             cccccCccCCCCCCCCCCCcchh-------hhhhHhHhhhh-----eEEeceeeeeccCcchHHHHHHHHHhCCCcccce
Q psy8157          11 FPKVTKPKHDSSTLNDKPPKKAS-------INLLKALQRYL-----RFLWAARRVAQKDLTIADIFREHAVRSPNKVIFM   78 (191)
Q Consensus        11 ~~~~~~~~~~~~~~~~~~~~~~~-------~rdl~~l~~~l-----~i~~~g~nv~~~e~~Ve~~~e~~l~~hP~k~~~~   78 (191)
                      -|.+|.||+++.+.+...|.++|       +.|-.|...++     +|+.+|+||++.+  ||    ++|.+||+     
T Consensus       358 g~~~~~GY~~~~~~t~~~f~~g~~~TGDlg~~~~dG~l~~~GR~dd~ik~~G~~v~p~e--IE----~~l~~~p~-----  426 (504)
T 1t5h_X          358 SDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDDMIISGGENIHPSE--IE----RVLGTAPG-----  426 (504)
T ss_dssp             CTTSCCCBTTCHHHHHHHEETTEEEEEEEEEECTTSCEEEEEEGGGCEEETTEEECHHH--HH----HHHTTSTT-----
T ss_pred             CceeeceecCCchhhhhhhcCCccccCcEEEECCCceEEEeCcccCEEEECCEEECHHH--HH----HHHHhCCC-----
Confidence            78999999998887777777777       23333333232     5688999999999  85    56689999     


Q ss_pred             eeeEEEEEEecCCCCCceEEEEEE-cCCCCCCHHHHHHHHHh-cCCCCCcccEEEEeccCCCCCCCCcchHHHhhcc
Q psy8157          79 FENTEWTAQQVPGYEGRAGMAAIL-DINKSLDVTAVSEGIKK-ALPSYARPLFIRCLREVEMTGTYKLKKLDLQKEG  153 (191)
Q Consensus        79 V~eaaVvGVpd~~~~ge~~~A~Vv-~~g~~~~~e~l~~~l~~-~Lp~ykvP~~v~~v~eLP~T~tGKi~K~~Lr~~~  153 (191)
                      |.||+|+|++++ ..|+.++|+|+ .++...+.++|.++|++ +||.|++|+.+.++++||+|++|||+|++|++..
T Consensus       427 V~~a~Vv~~~~~-~~g~~~~a~vv~~~~~~~~~~~l~~~~~~~~L~~~~~P~~i~~v~~lP~t~~GKi~r~~L~~~~  502 (504)
T 1t5h_X          427 VTEVVVIGLADQ-RWGQSVTACVVPRLGETLSADALDTFCRSSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQV  502 (504)
T ss_dssp             EEEEEEEEEECS-SSSEEEEEEEEECTTCCCCHHHHHHHHHTSSCCGGGSCSEEEECSCCCBCTTSCBCHHHHHHHH
T ss_pred             cceEEEEEeecC-CCCcEEEEEEEecCCcCcCHHHHHHHHhhccCcccccceEEEEhhhCCCCCCCCEeHHHHHHHh
Confidence            999999999987 46888899998 77777899999999998 9999999999999999999999999999999753
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 7e-04
d1amua_ 514 e.23.1.1 (A:) Phenylalanine activating domain of g 9e-04
d1mdba_ 536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 0.001
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Phenylalanine activating domain of gramicidin synthetase 1
species: Bacillus brevis [TaxId: 1393]

 Score = 37.2 bits (85), Expect = 7e-04
 Identities = 10/61 (16%), Positives = 26/61 (42%)

Query: 89  VPGYEGRAGMAAILDINKSLDVTAVSEGIKKALPSYARPLFIRCLREVEMTGTYKLKKLD 148
              ++ +  + A     K + +  + +   + LP+Y  P +   L ++ +T   K+ +  
Sbjct: 447 HKDHQEQPYLCAYFVSEKHIPLEQLRQFSSEELPTYMIPSYFIQLDKMPLTSNGKIDRKQ 506

Query: 149 L 149
           L
Sbjct: 507 L 507
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 99.8
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 99.78
d1amua_514 Phenylalanine activating domain of gramicidin synt 99.77
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 99.75
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 99.75
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 99.73
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 99.72
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: 4-chlorobenzoyl CoA ligase
species: Alcaligenes sp. [TaxId: 512]

Probab=99.80  E-value=1.5e-20  Score=161.53  Aligned_cols=133  Identities=11%  Similarity=0.087  Sum_probs=109.8

Q ss_pred             eeCcccccCccCCCCCCCCCCCcchh-------hhhhHhHhhhh-----eEEeceeeeeccCcchHHHHHHHHHhCCCcc
Q psy8157           8 ELGFPKVTKPKHDSSTLNDKPPKKAS-------INLLKALQRYL-----RFLWAARRVAQKDLTIADIFREHAVRSPNKV   75 (191)
Q Consensus         8 ~~~~~~~~~~~~~~~~~~~~~~~~~~-------~rdl~~l~~~l-----~i~~~g~nv~~~e~~Ve~~~e~~l~~hP~k~   75 (191)
                      ..+.+..+.+|+.+...+...+..+|       .+|-.|...++     .++.+|++|++.+  ||    ++|.+||+  
T Consensus       355 ~~~~~~~~~~~~~~~~~t~~~~~~g~~~TgD~g~~~~dG~l~~~GR~~d~ik~~G~~v~~~~--IE----~~l~~~p~--  426 (503)
T d3cw9a1         355 VAASDSAFVGYLNQPQATAEKLQDGWYRTSDVAVWTPEGTVRILGRVDDMIISGGENIHPSE--IE----RVLGTAPG--  426 (503)
T ss_dssp             EECCTTSCCCBTTCHHHHHHHEETTEEEEEEEEEECTTSCEEEEEESSCCEEETTEEECHHH--HH----HHHTTSTT--
T ss_pred             ccccccccccccCChhhhHHHhcCCceecccccccccCCeEEeCCCcCCeEEECCEEECHHH--HH----HHHHhCCC--
Confidence            34567778888888777766666777       33333333333     4678999999999  85    56689999  


Q ss_pred             cceeeeEEEEEEecCCCCCceEEEEEE-cCCCCCCHHHHHHHHH-hcCCCCCcccEEEEeccCCCCCCCCcchHHHhhc
Q psy8157          76 IFMFENTEWTAQQVPGYEGRAGMAAIL-DINKSLDVTAVSEGIK-KALPSYARPLFIRCLREVEMTGTYKLKKLDLQKE  152 (191)
Q Consensus        76 ~~~V~eaaVvGVpd~~~~ge~~~A~Vv-~~g~~~~~e~l~~~l~-~~Lp~ykvP~~v~~v~eLP~T~tGKi~K~~Lr~~  152 (191)
                         |.||+|+|++++ ..|+.++|+|+ .++...+.++|.++++ ++||.|++|+.|.++++||+|++|||+|++||++
T Consensus       427 ---V~~~~v~~~~~~-~~g~~~~a~v~~~~~~~~~~~~l~~~~~~~~l~~~~~P~~i~~v~~~P~t~~GKi~R~~L~~~  501 (503)
T d3cw9a1         427 ---VTEVVVIGLADQ-RWGQSVTACVVPRLGETLSADALDTFCRSSELADFKRPKRYFILDQLPKNALNKVLRRQLVQQ  501 (503)
T ss_dssp             ---EEEEEEEEEEET-TTEEEEEEEEEECTTCCCCHHHHHHHHHHSSSCGGGSCSEEEECSCCCBCTTSCBCHHHHHHH
T ss_pred             ---ccEEEEEEEECC-CCCeEEEEEEEeCCCCCCCHHHHHHHHHhcCCCCCCCccEEEEECCCCcCCCcCccHHHHHHh
Confidence               999999999997 46788899988 8888899999999995 6899999999999999999999999999999986
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure