Diaphorina citri psyllid: psy8160


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MKYVIQKNLVEGIVTSVRVPKLQQFGKTLNIKAIKTFQQLLYVDPSYLRANEVHLRLGLMFKVNNEYDSALKHLTLCLIDASPCTFTKLEGLMFKVNNEYDSALKHLTLCLIDASPCTFTKLEVRFHIAHLHEVQRKYKTAKDSYEQLLKEDDLPVHLKADICRQLGWMYHCIDTLGEKSHRETLAIHCLQKSIEADPKSGQSLYLLGRCFAAVGKVHDAFLAYRNSVEKSEGNADTWCSIGNKDFSNNSNREDYHQALNKYRDLGDFLVINNIPTSNNNRQCYNSYSTSIASCKHINNNKDFSNNSNREDYHQALNKYRDLGA
cHHHccHHHHHHHHHHcccHHHHHHHcccHHHHHHHHHHHHHcccccHHcHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHccc
*KYVIQKNLVEGIVTSVRVPKLQQFGKTLNIKAIKTFQQLLYVDPSYLRANEVHLRLGLMFKVNNEYDSALKHLTLCLIDASPCTFTKLEGLMFKVNNEYDSALKHLTLCLIDASPCTFTKLEVRFHIAHLHEVQRKYKTAKDSYEQLLKEDDLPVHLKADICRQLGWMYHCIDTLGEKSHRETLAIHCLQKSIEADPKSGQSLYLLGRCFAAVGKVHDAFLAYRNSVEKSEGNADTWCSIGNKDFSNNSNREDYHQALNKYRDLGDFLVINNIPTSNNNRQCYNSYSTSIASCKHINNNKDFSNNSNREDYHQALNKYRDL**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKYVIQKNLVEGIVTSVRVPKLQQFGKTLNIKAIKTFQQLLYVDPSYLRANEVHLRLGLMFKVNNEYDSALKHLTLCLIDASPCTFTKLEGLMFKVNNEYDSALKHLTLCLIDASPCTFTKLEVRFHIAHxxxxxxxxxxxxxxxxxxxxxDDLPVHLKADICRQLGWMYHCIDTLGEKSHRETLAIHCLQKSIEADPKSGQSLYLLGRCFAAVGKVHDAFLAYRNSVEKSEGNADTWCSIGNKDFSNNSNREDYHQALNKYRDLGDFLVINNIPTSNNNRQCYNSYSTSIASCKHINNNKDFSNNSNREDYHQALNKYRDLGA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Lysine-specific demethylase 6A Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.confidentO70546
Lysine-specific demethylase 6A Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27'. Plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.confidentO15550

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044666 [CC]MLL3/4 complexprobableGO:0031974, GO:0043229, GO:0005623, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0035097, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0003674 [MF]molecular_functionprobable
GO:0016577 [BP]histone demethylationprobableGO:0008214, GO:0044699, GO:0044267, GO:0006482, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0006996, GO:0009987, GO:0044710, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0070988, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0044763, GO:0016568, GO:0016569
GO:0035327 [CC]transcriptionally active chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0000785, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0005705 [CC]polytene chromosome interbandprobableGO:0005575, GO:0043232, GO:0044464, GO:0005700, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0005623, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HYM, chain B
Confidence level:very confident
Coverage over the Query: 14-305
View the alignment between query and template
View the model in PyMOL
Template: 2Y4T, chain A
Confidence level:very confident
Coverage over the Query: 13-321
View the alignment between query and template
View the model in PyMOL