Diaphorina citri psyllid: psy8172


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MFALMNSNLQPPDPKSTVLTTTDYTSEVGFWKQTTRPSNTALSSMEQVKAYLQTQGTCKCGLECPLQCDSVFSFDAKPRERATEVHEPSEPAVCDLDN
ccccccccccccccccEEEECcccccccccEEEECcccccccccHHHHHHHHHHccCCccccccccccccEECccccccccccccccccccccccccc
***************STVLTTTDYTSEVGFWKQTTRPSNTALSSMEQVKAYLQTQGTCKCGLECPLQCDSVFSFDA**********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFALMNSNLQPPDPKSTVLTTTDYTSEVGFWKQTTRPSNTALSSMEQVKAYLQTQGTCKCGLECPLQCDSVFSFDAKPRERATEVHEPSEPAVCDLDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003677 [MF]DNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KY8, chain A
Confidence level:confident
Coverage over the Query: 20-55,66-79
View the alignment between query and template
View the model in PyMOL