Diaphorina citri psyllid: psy8176


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MEHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP
ccccHHHccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccc
***********EYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRH********TPKWEILEYLAYSKFMQD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031545 [MF]peptidyl-proline 4-dioxygenase activityprobableGO:0051213, GO:0016706, GO:0016705, GO:0003824, GO:0003674, GO:0031543, GO:0016491
GO:0043412 [BP]macromolecule modificationprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170
GO:0005623 [CC]cellprobableGO:0005575

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V5F, chain A
Confidence level:very confident
Coverage over the Query: 99-159
View the alignment between query and template
View the model in PyMOL
Template: 1PC2, chain A
Confidence level:probable
Coverage over the Query: 59-84,101-131
View the alignment between query and template
View the model in PyMOL