Psyllid ID: psy8176

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MEHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP
ccccHHHccHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHcccc
ccHHHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccc
mehaeaakdvpeylanPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYkqdlkfptdedlSGAATALLRLQDTYKLETASVargelngvqyttqltasdcfelgrqsyntqdFYHTALWMGEAlkrhdmerngtstpkWEILEYLAYSKFMQDP
mehaeaakdvpeylanpINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEAlkrhdmerngtstpkweILEYLAYSKFMQDP
MEHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP
***********EYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRH********TPKWEILEYLAYSK*****
************YLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKR***********KWEILEYLAYSKFMQD*
********DVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP
*****AAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query159 2.2.26 [Sep-21-2011]
Q20065 539 Prolyl 4-hydroxylase subu yes N/A 0.955 0.282 0.471 3e-36
Q5ZLK5 534 Prolyl 4-hydroxylase subu yes N/A 0.937 0.279 0.467 3e-33
O15460 535 Prolyl 4-hydroxylase subu yes N/A 0.937 0.278 0.440 4e-31
Q60716 537 Prolyl 4-hydroxylase subu yes N/A 0.911 0.270 0.467 9e-31
Q5RAG8 534 Prolyl 4-hydroxylase subu no N/A 0.937 0.279 0.427 2e-29
P13674 534 Prolyl 4-hydroxylase subu no N/A 0.937 0.279 0.427 2e-29
P16924 516 Prolyl 4-hydroxylase subu no N/A 0.937 0.288 0.460 2e-29
Q1RMU3 534 Prolyl 4-hydroxylase subu no N/A 0.937 0.279 0.421 3e-29
Q10576 559 Prolyl 4-hydroxylase subu no N/A 0.905 0.257 0.434 7e-29
Q60715 534 Prolyl 4-hydroxylase subu no N/A 0.937 0.279 0.421 9e-29
>sp|Q20065|P4HA2_CAEEL Prolyl 4-hydroxylase subunit alpha-2 OS=Caenorhabditis elegans GN=phy-2 PE=1 SV=1 Back     alignment and function desciption
 Score =  150 bits (379), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 109/157 (69%), Gaps = 5/157 (3%)

Query: 3   HAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMT--RYKQDLKFP 60
           HAE+    PE++ NPINA+L++KRLT +WK+ E+ M ++     + N+T  R + ++KFP
Sbjct: 66  HAESVG--PEFVTNPINAYLLIKRLTTEWKKVENIMLNNKASTFLKNITDNRVRSEVKFP 123

Query: 61  TDEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYH 120
            +EDLSGAATALLRLQDTY L+T  ++ G + G + + +L+  D FE+GR +YN +D+YH
Sbjct: 124 GEEDLSGAATALLRLQDTYSLDTLDLSNGIIGGEKVSNKLSGHDTFEVGRSAYNQKDYYH 183

Query: 121 TALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQ 157
             +WM  AL + + E N  +  +WEILEYLAYS + Q
Sbjct: 184 CLMWMQVALVKIENE-NPPTIEEWEILEYLAYSLYQQ 219
Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.
Caenorhabditis elegans (taxid: 6239)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 1EC: .EC: 2
>sp|Q5ZLK5|P4HA2_CHICK Prolyl 4-hydroxylase subunit alpha-2 OS=Gallus gallus GN=P4HA2 PE=2 SV=1 Back     alignment and function description
>sp|O15460|P4HA2_HUMAN Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens GN=P4HA2 PE=1 SV=1 Back     alignment and function description
>sp|Q60716|P4HA2_MOUSE Prolyl 4-hydroxylase subunit alpha-2 OS=Mus musculus GN=P4ha2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RAG8|P4HA1_PONAB Prolyl 4-hydroxylase subunit alpha-1 OS=Pongo abelii GN=P4HA1 PE=2 SV=1 Back     alignment and function description
>sp|P13674|P4HA1_HUMAN Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens GN=P4HA1 PE=1 SV=2 Back     alignment and function description
>sp|P16924|P4HA1_CHICK Prolyl 4-hydroxylase subunit alpha-1 OS=Gallus gallus GN=P4HA1 PE=1 SV=1 Back     alignment and function description
>sp|Q1RMU3|P4HA1_BOVIN Prolyl 4-hydroxylase subunit alpha-1 OS=Bos taurus GN=P4HA1 PE=1 SV=1 Back     alignment and function description
>sp|Q10576|P4HA1_CAEEL Prolyl 4-hydroxylase subunit alpha-1 OS=Caenorhabditis elegans GN=dpy-18 PE=1 SV=2 Back     alignment and function description
>sp|Q60715|P4HA1_MOUSE Prolyl 4-hydroxylase subunit alpha-1 OS=Mus musculus GN=P4ha1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
328696638 534 PREDICTED: prolyl 4-hydroxylase subunit 0.974 0.290 0.698 9e-59
193688213 552 PREDICTED: prolyl 4-hydroxylase subunit 0.974 0.280 0.698 9e-59
380025232 537 PREDICTED: prolyl 4-hydroxylase subunit 0.981 0.290 0.634 1e-52
340722330 557 PREDICTED: prolyl 4-hydroxylase subunit 0.981 0.280 0.628 2e-52
350416719 557 PREDICTED: prolyl 4-hydroxylase subunit 0.981 0.280 0.628 2e-52
383864775 550 PREDICTED: prolyl 4-hydroxylase subunit 0.981 0.283 0.628 7e-52
157142028 287 prolyl 4-hydroxylase alpha subunit 1, pu 0.974 0.540 0.621 2e-51
242018356 534 Prolyl 4-hydroxylase alpha-1 subunit pre 0.974 0.290 0.639 3e-51
157114985 545 prolyl 4-hydroxylase alpha subunit 1, pu 0.974 0.284 0.621 1e-50
170064960 545 prolyl 4-hydroxylase subunit alpha-1 [Cu 0.974 0.284 0.621 2e-50
>gi|328696638|ref|XP_003240086.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  231 bits (588), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 109/156 (69%), Positives = 130/156 (83%), Gaps = 1/156 (0%)

Query: 2   EHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPT 61
           EH+ AA+DV  YL+NPIN +L+VKRLT DW + E  M+D  Y+ AM N+T+Y++ LKFPT
Sbjct: 67  EHSIAARDVTNYLSNPINDYLLVKRLTSDWHKTEQLMQDPYYETAMKNLTQYRELLKFPT 126

Query: 62  DEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHT 121
           DEDL+GAATAL+RLQDTYKL+TASVARGELNG+QY+TQL+A DCFELGRQSYN  DFYHT
Sbjct: 127 DEDLTGAATALIRLQDTYKLDTASVARGELNGIQYSTQLSAGDCFELGRQSYNGYDFYHT 186

Query: 122 ALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQ 157
            LWM EAL RH+ ER+   T +WEILEYLAYS FMQ
Sbjct: 187 ELWMNEALNRHEQERSNV-TVRWEILEYLAYSTFMQ 221

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193688213|ref|XP_001943683.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|380025232|ref|XP_003696381.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Apis florea] Back     alignment and taxonomy information
>gi|340722330|ref|XP_003399560.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350416719|ref|XP_003491070.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383864775|ref|XP_003707853.1| PREDICTED: prolyl 4-hydroxylase subunit alpha-2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|157142028|ref|XP_001647787.1| prolyl 4-hydroxylase alpha subunit 1, putative [Aedes aegypti] gi|108868200|gb|EAT32455.1| AAEL015284-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|242018356|ref|XP_002429643.1| Prolyl 4-hydroxylase alpha-1 subunit precursor, putative [Pediculus humanus corporis] gi|212514628|gb|EEB16905.1| Prolyl 4-hydroxylase alpha-1 subunit precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|157114985|ref|XP_001658091.1| prolyl 4-hydroxylase alpha subunit 1, putative [Aedes aegypti] gi|108877086|gb|EAT41311.1| AAEL007038-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170064960|ref|XP_001867743.1| prolyl 4-hydroxylase subunit alpha-1 [Culex quinquefasciatus] gi|167882146|gb|EDS45529.1| prolyl 4-hydroxylase subunit alpha-1 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query159
FB|FBgn0039776 550 PH4alphaEFB "prolyl-4-hydroxyl 0.981 0.283 0.563 5.6e-45
WB|WBGene00004025 539 phy-2 [Caenorhabditis elegans 0.955 0.282 0.471 4e-35
UNIPROTKB|Q5ZLK5 534 P4HA2 "Prolyl 4-hydroxylase su 0.937 0.279 0.467 1.8e-33
UNIPROTKB|F1P1W4 536 P4HA2 "Prolyl 4-hydroxylase su 0.937 0.277 0.467 1.9e-33
UNIPROTKB|F1MJQ4 533 P4HA2 "Uncharacterized protein 0.937 0.279 0.440 5.1e-31
UNIPROTKB|G3N2F2 535 P4HA2 "Uncharacterized protein 0.937 0.278 0.440 5.3e-31
UNIPROTKB|F1NPC3 515 P4HA1 "Prolyl 4-hydroxylase su 0.937 0.289 0.467 8.4e-31
UNIPROTKB|O15460 535 P4HA2 "Prolyl 4-hydroxylase su 0.937 0.278 0.440 1.2e-30
UNIPROTKB|I3L5Y0 525 P4HA2 "Uncharacterized protein 0.937 0.283 0.440 2.2e-30
UNIPROTKB|I3L769 538 P4HA2 "Uncharacterized protein 0.937 0.276 0.440 2.7e-30
FB|FBgn0039776 PH4alphaEFB "prolyl-4-hydroxylase-alpha EFB" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 473 (171.6 bits), Expect = 5.6e-45, P = 5.6e-45
 Identities = 89/158 (56%), Positives = 123/158 (77%)

Query:     2 EHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPT 61
             EH++A+ D+  Y++NPINA+L+ KRLT DW+Q E+ M+  V  + + N+T+Y+  LKFP+
Sbjct:    70 EHSDASHDITAYVSNPINAYLLTKRLTTDWRQVENLMEHDVGTDFLQNITQYRSLLKFPS 129

Query:    62 DEDLSGAATALLRLQDTYKLETASVARGELNGVQYTTQLTASDCFELGRQSYNTQDFYHT 121
             DEDL+GAA ALLRLQDTY+L+T+SVARG+LNG+QY+T++++ DCFELGRQSY   D+YHT
Sbjct:   130 DEDLNGAAVALLRLQDTYQLDTSSVARGKLNGIQYSTEMSSDDCFELGRQSYVNHDYYHT 189

Query:   122 ALWMGEALKRHDME-RNGT-STPKWEILEYLAYSKFMQ 157
              LWM EA+ R   E  N T S  K +ILEYLA+S + +
Sbjct:   190 VLWMNEAMARMLEEPTNHTQSFTKADILEYLAFSTYKE 227
GO:0016222 "procollagen-proline 4-dioxygenase complex" evidence=IC
GO:0018401 "peptidyl-proline hydroxylation to 4-hydroxy-L-proline" evidence=ISS
GO:0004656 "procollagen-proline 4-dioxygenase activity" evidence=ISS
GO:0005506 "iron ion binding" evidence=IEA
GO:0031418 "L-ascorbic acid binding" evidence=IEA
GO:0016702 "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0005783 "endoplasmic reticulum" evidence=IEA
WB|WBGene00004025 phy-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLK5 P4HA2 "Prolyl 4-hydroxylase subunit alpha-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1W4 P4HA2 "Prolyl 4-hydroxylase subunit alpha-2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MJQ4 P4HA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3N2F2 P4HA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPC3 P4HA1 "Prolyl 4-hydroxylase subunit alpha-1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|O15460 P4HA2 "Prolyl 4-hydroxylase subunit alpha-2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L5Y0 P4HA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3L769 P4HA2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.14.11LOW CONFIDENCE prediction!
4th Layer1.14.11.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
pfam08336134 pfam08336, P4Ha_N, Prolyl 4-Hydroxylase alpha-subu 1e-33
>gnl|CDD|203913 pfam08336, P4Ha_N, Prolyl 4-Hydroxylase alpha-subunit, N-terminal region Back     alignment and domain information 
 Score =  115 bits (289), Expect = 1e-33
 Identities = 48/93 (51%), Positives = 63/93 (67%), Gaps = 2/93 (2%)

Query: 2   EHAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPT 61
           EH +A  D  EYL NP+NAF ++KRL  DW + E+YM+  V +E + N+   ++    PT
Sbjct: 44  EHEKAKSDPEEYLGNPLNAFSLIKRLHTDWPKLENYMEKDVGEELIKNLEELRK--SLPT 101

Query: 62  DEDLSGAATALLRLQDTYKLETASVARGELNGV 94
           DEDL GAA ALLRLQDTY L+   +A+G LNGV
Sbjct: 102 DEDLEGAARALLRLQDTYNLDPKDLAKGVLNGV 134

The members of this family are eukaryotic proteins, and include all three isoforms of the prolyl 4-hydroxylase alpha subunit. This enzyme (EC:1.14.11.2) is important in the post-translational modification of collagen, as it catalyzes the formation of 4-hydroxyproline. In vertebrates, the complete enzyme is an alpha2-beta2 tetramer; the beta-subunit is identical to protein disulphide isomerase. The function of the N-terminal region featured in this family does not seem to be known. Length = 134

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 159
PF08336134 P4Ha_N: Prolyl 4-Hydroxylase alpha-subunit, N-term 100.0
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.21
PF08631 278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 95.97
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.46
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.46
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 92.0
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 91.18
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 91.17
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 91.09
smart0067136 SEL1 Sel1-like repeats. These represent a subfamil 90.8
PRK10803263 tol-pal system protein YbgF; Provisional 90.08
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 90.04
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 87.49
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 87.03
cd00189100 TPR Tetratricopeptide repeat domain; typically con 86.9
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 86.01
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 85.0
PF1342844 TPR_14: Tetratricopeptide repeat 84.95
PF11817247 Foie-gras_1: Foie gras liver health family 1; Inte 84.91
PF0823839 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like r 84.09
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 83.98
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 83.97
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 83.83
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 83.6
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 82.28
PF08631278 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: 81.27
>PF08336 P4Ha_N: Prolyl 4-Hydroxylase alpha-subunit, N-terminal region; InterPro: IPR013547 The members found in this entry are eukaryotic proteins, and include all three isoforms of the prolyl 4-hydroxylase alpha subunit Back     alignment and domain information 
Probab=100.00  E-value=7.2e-34  Score=211.39  Aligned_cols=90  Identities=48%  Similarity=0.811  Sum_probs=86.0

Q ss_pred             hhhhhcChhhhhhchhHHHHHHHhhhhhHHHHHHHHHhhhhHHHHHHHHHhhhcCCCCChhhHHHHHHHHHHHHHHhCCC
Q psy8176           3 HAEAAKDVPEYLANPINAFLVVKRLTLDWKQAEHYMKDHVYQEAMDNMTRYKQDLKFPTDEDLSGAATALLRLQDTYKLE   82 (159)
Q Consensus         3 ~~~~~~~~e~yl~nPlnaF~LirRl~~dW~~~~~~~~~~~~~~~i~~l~~~~~~~~~P~~~Dl~~A~~al~RLQ~~Y~L~   82 (159)
                      +..+..+|++|++||||||+|||||++||++|+++|+++++.+++..++..+..  +||.+|++||+.||+|||+||+|+
T Consensus        45 ~~~~~~d~e~yl~nPlnaF~LIrRl~~dW~~~~~~~~~~~~~~~~~~~~~~~~~--~Pt~~Dl~gA~~~l~RLQ~~Y~L~  122 (134)
T PF08336_consen   45 HEKAKSDPEEYLSNPLNAFSLIRRLHQDWPKWEKLMEQPVGQEQLQNLQELRSK--LPTEEDLEGAAEGLLRLQDTYNLD  122 (134)
T ss_pred             HHHhhcchhhhhhcHHHHHHHHHHHHHhhhhHHHHHHHhhhHHHHHHHHHHHhc--CCCHHHHHHHHHHHHHHHHHhCCC
Confidence            345677999999999999999999999999999999999999999999999988  999999999999999999999999


Q ss_pred             hHHhhccccCCc
Q psy8176          83 TASVARGELNGV   94 (159)
Q Consensus        83 ~~dla~G~l~g~   94 (159)
                      +.|||+|+|.|+
T Consensus       123 ~~dlA~G~l~G~  134 (134)
T PF08336_consen  123 PSDLANGLLQGV  134 (134)
T ss_pred             HHHHhccccCCC
Confidence            999999999986

This enzyme (1.14.11.2 from EC) is important in the post-translational modification of collagen, as it catalyses the formation of 4-hydroxyproline. In vertebrates, the complete enzyme is an alpha2-beta2 tetramer; the beta-subunit is identical to protein disulphide isomerase [, , , ]. The function of the N-terminal region featured in this family does not seem to be known. ; GO: 0004656 procollagen-proline 4-dioxygenase activity, 0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen, 0055114 oxidation-reduction process, 0005783 endoplasmic reticulum
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>smart00671 SEL1 Sel1-like repeats Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>PF11817 Foie-gras_1: Foie gras liver health family 1; InterPro: IPR021773 Mutating the gene foie gras in zebrafish has been shown to affect development; the mutants develop large, lipid-filled hepatocytes in the liver, resembling those in individuals with fatty liver disease [] Back     alignment and domain information
>PF08238 Sel1: Sel1 repeat; InterPro: IPR006597 Sel1-like repeats are tetratricopeptide repeat sequences originally identified in a Caenorhabditis elegans receptor molecule which is a key negative regulator of the Notch pathway [] Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
2v5f_A104 Crystal Structure Of Wild Type Peptide-Binding Doma 2e-09
1tjc_A108 Crystal Structure Of Peptide-Substrate-Binding Doma 3e-08
>pdb|2V5F|A Chain A, Crystal Structure Of Wild Type Peptide-Binding Domain Of Human Type I Collagen Prolyl 4-Hydroxylase Length = 104 Back     alignment and structure 
Iteration: 1

 Score = 58.5 bits (140), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%)
Query: 100 LTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQ 157
           LTA DCFELG+ +Y   D+YHT LWM +AL++ D E   ++  K  +L+YL+Y+ + Q
Sbjct: 3   LTAEDCFELGKVAYTEADYYHTELWMEQALRQLD-EGEISTIDKVSVLDYLSYAVYQQ 59
>pdb|1TJC|A Chain A, Crystal Structure Of Peptide-Substrate-Binding Domain Of Human Type I Collagen Prolyl 4-Hydroxylase Length = 108 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query159
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 3e-16
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Length = 104 Back     alignment and structure
 Score = 68.9 bits (168), Expect = 3e-16
 Identities = 27/59 (45%), Positives = 38/59 (64%), Gaps = 1/59 (1%)

Query: 100 LTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQD 158
           LTA DCFELG+ +Y   D+YHT LWM +AL++ D     T   K  +L+YL+Y+ + Q 
Sbjct: 3   LTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTID-KVSVLDYLSYAVYQQG 60

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 99.51
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 94.97
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.5
2l6j_A111 TPR repeat-containing protein associated with HSP; 94.36
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 93.42
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 93.32
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 93.19
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 92.92
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 92.71
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 92.44
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 92.39
3q49_B137 STIP1 homology and U box-containing protein 1; E3 92.26
3vtx_A 184 MAMA; tetratricopeptide repeats (TPR) containing p 92.15
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 92.15
3k9i_A117 BH0479 protein; putative protein binding protein, 92.13
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 92.12
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 91.36
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 91.18
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 91.02
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 90.99
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 90.8
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 90.77
2kat_A115 Uncharacterized protein; NESG, structure, structur 90.69
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 90.4
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 90.02
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 90.01
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 89.87
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 89.85
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 89.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 89.37
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 89.35
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 89.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 89.28
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 89.28
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 89.25
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 89.22
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 89.14
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 88.82
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 88.63
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 88.5
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 88.3
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 88.28
3u3w_A293 Transcriptional activator PLCR protein; ternary co 87.95
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 87.89
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 87.35
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 87.24
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 86.93
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 86.93
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 86.93
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 86.63
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 86.46
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 86.38
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 86.34
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 86.13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 86.11
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 85.95
3q49_B137 STIP1 homology and U box-containing protein 1; E3 85.84
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 85.51
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 85.49
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 85.48
3u3w_A293 Transcriptional activator PLCR protein; ternary co 85.39
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 85.17
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 85.07
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 84.97
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 84.94
1pc2_A152 Mitochondria fission protein; unknown function; NM 84.93
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 84.88
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 84.68
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 84.44
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 84.28
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 84.27
1klx_A138 Cysteine rich protein B; structural genomics, heli 83.65
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 83.47
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 83.43
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 83.29
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 83.26
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 82.93
3u4t_A 272 TPR repeat-containing protein; structural genomics 82.72
1klx_A138 Cysteine rich protein B; structural genomics, heli 82.67
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 82.58
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 82.51
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 82.36
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 82.34
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 82.34
2l6j_A111 TPR repeat-containing protein associated with HSP; 81.84
3rjv_A 212 Putative SEL1 repeat protein; alpha-alpha superhel 81.76
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 81.6
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 81.59
4i17_A228 Hypothetical protein; TPR repeats protein, structu 81.4
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 81.33
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 80.95
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 80.74
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 80.63
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 80.42
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 80.21
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 80.13
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
Probab=99.51  E-value=4.5e-14  Score=97.97  Aligned_cols=60  Identities=45%  Similarity=0.833  Sum_probs=55.3

Q ss_pred             CCCHHHHHHHHHHHHhCCCchhHHHHHHHHHhhhhccCCCCCCCHHHHHHHHHHhHhhcCC
Q psy8176          99 QLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP  159 (159)
Q Consensus        99 ~Ls~~DC~~iG~~~y~~~dy~~A~~Wl~~Al~~~~~~~~~~~~~~~~il~~la~s~~~~g~  159 (159)
                      +||+.|||+||+++|+.++|.+|+.|+++|+++.+.+...+.. ..+|+.+||.|.+++|+
T Consensus         2 ~Lsa~dc~~lG~~~~~~~~y~~A~~W~~~Al~~~~~~~~~~~~-~~~i~~~L~~~~~~~g~   61 (104)
T 2v5f_A            2 FLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTID-KVSVLDYLSYAVYQQGD   61 (104)
T ss_dssp             CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHTTCCCSSC-HHHHHHHHHHHHHHTTC
T ss_pred             CCCHHHHHHHHHHHHHccchHHHHHHHHHHHHhhhccCCCccc-HHHHHHHHHHHHHHccC
Confidence            5999999999999999999999999999999998776555678 99999999999999985
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 159
d1tjca_95 a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subuni 1e-04
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Prolyl 4-hydroxylase alpha-1 subunit, P4HA1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.1 bits (85), Expect = 1e-04
 Identities = 25/58 (43%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 100 LTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQ 157
           LTA D FELG+ +Y   D+YHT LWM E   R   E   ++  K  +L+YL+Y+ + Q
Sbjct: 3   LTAEDSFELGKVAYTEADYYHTELWM-EQALRQLDEGEISTIDKVSVLDYLSYAVYQQ 59

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query159
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.44
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.55
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 92.71
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 92.57
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 92.29
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 91.12
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 90.83
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 90.79
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 90.06
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 88.93
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 87.4
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 86.59
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 86.35
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 85.16
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 83.61
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 82.97
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 81.51
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 81.35
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 80.03
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Prolyl 4-hydroxylase alpha-1 subunit, P4HA1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.44  E-value=1.2e-13  Score=93.11  Aligned_cols=60  Identities=43%  Similarity=0.769  Sum_probs=55.1

Q ss_pred             CCCHHHHHHHHHHHHhCCCchhHHHHHHHHHhhhhccCCCCCCCHHHHHHHHHHhHhhcCC
Q psy8176          99 QLTASDCFELGRQSYNTQDFYHTALWMGEALKRHDMERNGTSTPKWEILEYLAYSKFMQDP  159 (159)
Q Consensus        99 ~Ls~~DC~~iG~~~y~~~dy~~A~~Wl~~Al~~~~~~~~~~~~~~~~il~~la~s~~~~g~  159 (159)
                      -||++|||.||+.+|+.|+|.+|..|+++|+++.........+ +.+++..||.+.+++|+
T Consensus         2 ~Lsaddc~~lG~~~~~~g~y~~A~~~~~~Al~~~~~~~~~~~~-~~~~l~~Lg~~~~~~g~   61 (95)
T d1tjca_           2 FLTAEDSFELGKVAYTEADYYHTELWMEQALRQLDEGEISTID-KVSVLDYLSYAVYQQGD   61 (95)
T ss_dssp             CCCHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHTTCCCSSC-HHHHHHHHHHHHHHTTC
T ss_pred             cccHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHhhhhccCcc-HHHHHHHHhhHHHhcCC
Confidence            3899999999999999999999999999999998876666677 99999999999999985
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure