Diaphorina citri psyllid: psy8179


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80----
MLSEMSDELLKNSNDKNGEPSVIWDKLDKEDDAEDIIWDDDTPSPIQEFYKDQTVFITGATGFLGSLLVEKLLRCCPQMLSLRF
cHHHHHHHHHccccccccccEEEEcccccccccccccccccccccHHHHHcccEEEEEccHHHHHHHHHHHHHHHcccccEECc
******D***************IWDK******AEDIIWDDDTPSPIQEFYKDQTVFITGATGFLGSLLVEKLLRCCPQMLSLRF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSEMSDELLKNSNDKNGEPSVIWDKLDKEDDAEDIIWDDDTPSPIQEFYKDQTVFITGATGFLGSLLVEKLLRCCPQMLSLRF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative fatty acyl-CoA reductase CG5065 Catalyzes the reduction of saturated fatty acyl-CoA to fatty alcohols.confidentA1ZAI5
Fatty acyl-CoA reductase 1 Catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.confidentQ66H50
Fatty acyl-CoA reductase 1 Catalyzes the reduction of saturated fatty acyl-CoA with chain length C16 or C18 to fatty alcohols.confidentQ5R834

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0080019 [MF]fatty-acyl-CoA reductase (alcohol-forming) activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0050062 [MF]long-chain-fatty-acyl-CoA reductase activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0010025 [BP]wax biosynthetic processprobableGO:0009058, GO:0008150, GO:0010166, GO:0008152
GO:0035336 [BP]long-chain fatty-acyl-CoA metabolic processprobableGO:0035383, GO:0051186, GO:0006637, GO:0006732, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0008152, GO:0006793, GO:0035337
GO:0046474 [BP]glycerophospholipid biosynthetic processprobableGO:0006650, GO:0044249, GO:0044255, GO:0045017, GO:0044710, GO:0071704, GO:0006644, GO:0006629, GO:1901576, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:0046486, GO:0090407, GO:0008610, GO:0044238, GO:0008654, GO:0044237, GO:0006796, GO:0006793, GO:0019637

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DQV, chain A
Confidence level:confident
Coverage over the Query: 28-63
View the alignment between query and template
View the model in PyMOL