Diaphorina citri psyllid: psy8209

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------27

MHNRYKRSNFTYVSPCVKYMIFLLNFIFWLLGALLIAVGLYAFLDKWEASGLLKLETVYDVILNIALVLVILGAIIFIVSFAGCVGALRENTCLLKFYSLCLLIFFLLEMLVAVIGFVFPHHIQATLEESFTEKIIHMYRDDADLQNLIDFAQQEFQCCGLSSEGYMDWSKNEYFNCSSPSVEKCGVPFSCCINATDITSGLVNIMCGYGAQQSSGVLRYGQLPQVAEASKKVWTSGCIEVMRLWAERNLYTIAGVALGVALSQVRYTW

cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc

*********FTYVSPCVKYMIFLLNFIFWLLGALLIAVGLYAFLDKWEASGLLKLETVYDVILNIALVLVILGAIIFIVSFAGCVGALRENTCLLKFYSLCLLIFFLLEMLVAVIGFVFPHHIQATLEESFTEKIIHMYRDDADLQNLIDFAQQEFQCCGLSSEGYMDWSKNEYFNCSSPSVEKCGVPFSCCINATDITSGLVNIMCGYGAQQSSGVLRYGQLPQVAEASKKVWTSGCIEVMRLWAERNLYTIAGVALGVALSQVRYTW

xxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tetraspanin-33	Plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.	confident	Q3SYV5
Tetraspanin-33		confident	Q5RH71
Tetraspanin-33	Plays an important role in normal erythropoiesis. It has a role in the differentiation of erythroid progenitors.	confident	Q8R3S2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0045747 [BP]	positive regulation of Notch signaling pathway	probable	GO:0023051, GO:0009966, GO:0009967, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0008593, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0006911 [BP]	phagocytosis, engulfment	probable	GO:0009987, GO:0006909, GO:0016192, GO:0016044, GO:0071840, GO:0006810, GO:0010324, GO:0008150, GO:0061024, GO:0044765, GO:0044763, GO:0016043, GO:0006897, GO:0051234, GO:0051179, GO:0044699
GO:0007298 [BP]	border follicle cell migration	probable	GO:0048610, GO:0048870, GO:0030154, GO:0048468, GO:0019953, GO:0006928, GO:0007292, GO:0051674, GO:0007297, GO:0001667, GO:0044699, GO:0000003, GO:0048869, GO:0030707, GO:0051179, GO:0007276, GO:0016477, GO:0048477, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0009987, GO:0044767, GO:0022414, GO:0008150, GO:0022412, GO:0090132, GO:0090130, GO:0040011, GO:0044702, GO:0010631, GO:0044707, GO:0003006, GO:0048856, GO:0044763
GO:0007399 [BP]	nervous system development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008283 [BP]	cell proliferation	probable	GO:0008150, GO:0044699
GO:0016021 [CC]	integral to membrane	probable	GO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0001772 [CC]	immunological synapse	probable	GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0007155 [BP]	cell adhesion	probable	GO:0008150, GO:0009987, GO:0022610, GO:0044763, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1G8Q, chain A
Confidence level:confident
Coverage over the Query: 117-172,186-207,230-249
View the alignment between query and template
View the model in PyMOL