Diaphorina citri psyllid: psy8232


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MTGDQILNFLSSITFIGQPAEVYKFGPQLWMFGVSCFFVIPIVGYIFVPFFQKNNFTSAYQYFGERFSRNLQLLASTMFTVQMVLYLALVLYAPAMALHQVTGLNTMMVVSVMFLVCIFYTTIGGMKAVVWTDSFQVVVLYFAMFAILCKGTLDIGGFSVVWQRNAAYNRTTLLSWNPDPTERYSIWSALFGSAFLHIVFYGGNQLQIQRYLTVDSAAKARQIDYDQMIMDDNIDVIHVMIKYVVTTLT
cEEHHHHHHHHHHHHHcccccHHcccHHHHHHHHHHHHHHHHHHHEEEcEEEccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHEEEEEcccccEEEEEHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MTGDQILNFLSSITFIGQPAEVYKFGPQLWMFGVSCFFVIPIVGYIFVPFFQKNNFTSAYQYFGERFSRNLQLLASTMFTVQMVLYLALVLYAPAMALHQVTGLNTMMVVSVMFLVCIFYTTIGGMKAVVWTDSFQVVVLYFAMFAILCKGTLDIGGFSVVWQRNAAYNRTTLLSWNPDPTERYSIWSALFGSAFLHIVFYGGNQLQIQRYLTVDSAAKARQIDYDQMIMDDNIDVIHVMIKYVVTTLT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGDQILNFLSSITFIGQPAEVYKFGPQLWMFGVSCFFVIPIVGYIFVPFFQKNNFTSAYQYFGERFSRNLQLLASTMFTVQMVLYLALVLYAPAMALHQVTGLNTMMVVSVMFLVCIFYTTIGGMKAVVWTDSFQVVVLYFAMFAILCKGTLDIGGFSVVWQRNAAYNRTTLLSWNPDPTERYSIWSALFGSAFLHIVFYGGNQLQIQRYLTVDSAAKARQIDYDQMIMDDNIDVIHVMIKYVVTTLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006811 [BP]ion transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0015075 [MF]ion transmembrane transporter activityprobableGO:0022891, GO:0005215, GO:0022857, GO:0022892, GO:0003674
GO:0015291 [MF]secondary active transmembrane transporter activityprobableGO:0005215, GO:0022857, GO:0003674, GO:0022804
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XQ2, chain A
Confidence level:very confident
Coverage over the Query: 2-246
View the alignment between query and template
View the model in PyMOL