Diaphorina citri psyllid: psy8246

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------

MSALQPNSGGSATGNPRNKTALKPGHSLMDWIRLGNSGVNLSGIQGRILVSKAQLAEHNKEDDMWMCIRGVVYNVTRYMDFHPGGREELMRGAGMDATELFNKVHPWVNYESILQKCIVGKMGSSLPDENPFVIPSKKSSEPKPLPSINVPVKPFENEKASSNNVSKSFYSMDWFQQLNFICFVFYLKSSCPKVLITLNENNTDLSLLINERSLLLHLEQPVKWPCQVKINLNVGKLQLQLNKEEAKLWKHHSTKTSTNNITSNSTSSVNIPVSKFNTMRLLHQEQVTHNVVLITLEYTSPMFFYVPVGHHVFIKFIVNDVDISKPYTPVEPLQAAPLSYSNTLTFLIKSYEDGLLSPLLCGLREGQELEVSSPEGKFDVGLIGKRNKLVLLAAGTGLTPMIPVINWSIQSQRQSVQLVFFNRTEQDIIWRDQLDTFASKNSKPSSPRNPSTEIKPLKNIISFLMRIRTTLKRVELEDLLNSNSLVYSQLNLPYAVAAVADKMTGMENKMNPEIPPNNPTTQNTTAE

cccccccccccccccccccccccccccccccccccccccccccccccEEccHHHHHHccccccEEEEEccEEEEccccccccccccHHHHHHcccccHHHHHHccccHHHHHHHHccEEEECccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEEEcccccccEEEEccccccccHHHccccEEEEEEcccccccCEEEEEEEccEEEEEEHHHHHHHHccccccccccccccccccccccccccCEEEEEEEEEEEcccEEEEEEEcccccEEccccccEEEEEEEEccCEEEECccccccccccccccccEEEEEEEEcccccccccccccccccEEEEcccCEEEEEcccccccEEEEEEccccHHHHHHHHHHHHcccccEEEEEEcccccccEEcHHHHHHHHHHccccccccccccccccccccccccEEEHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHcccccccccccccccccccccccc

*************************HSLMDWIRLGNSGVNLSGIQGRILVSKAQLAEHNKEDDMWMCIRGVVYNVTRYMDFHPGGREELMRGAGMDATELFNKVHPWVNYESILQKCIVGKM*******************************************SKSFYSMDWFQQLNFICFVFYLKSSCPKVLITLNENNTDLSLLINERSLLLHLEQPVKWPCQVKINLNVGKLQLQLNKEEAKLWK*******************NIPVSKFNTMRLLHQEQVTHNVVLITLEYTSPMFFYVPVGHHVFIKFIVNDVDISKPYTPVEPLQAAPLSYSNTLTFLIKSYEDGLLSPLLCGLREGQELEVSSPEGKFDVGLIGKRNKLVLLAAGTGLTPMIPVINWSIQSQRQSVQLVFFNRTEQDIIWRDQLDTFASKNSKPSSPRNPSTEIKPLKNIISFLMRIRTTLKRVELEDLLNSNSLVYSQLNLPYAVAAVAD**************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Cytochrome b5 reductase 4	NADH-cytochrome b5 reductase involved in endoplasmic reticulum stress response pathway. Plays a critical role in protecting pancreatic beta-cells against oxidant stress, possibly by protecting the cell from excess buildup of reactive oxygen species (ROS). Reduces a variety of substrates in vitro, such as cytochrome c, feericyanide and methemoglobin.	confident	Q7L1T6
Cytochrome b5 reductase 4	NADH-cytochrome b5 reductase involved in endoplasmic reticulum stress response pathway. Plays a critical role in protecting pancreatic beta-cells against oxidant stress, possibly by protecting the cell from excess buildup of reactive oxygen species (ROS).	confident	Q3TDX8
Cytochrome b5 reductase 4	NADH-cytochrome b5 reductase involved in endoplasmic reticulum stress response pathway.	confident	Q28CZ9

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044281 [BP]	small molecule metabolic process	probable	GO:0044710, GO:0008150, GO:0008152
GO:1901360 [BP]	organic cyclic compound metabolic process	probable	GO:0071704, GO:0008150, GO:0008152
GO:0006091 [BP]	generation of precursor metabolites and energy	probable	GO:0009987, GO:0008150, GO:0008152, GO:0044237
GO:0031090 [CC]	organelle membrane	probable	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:1901363 [MF]	heterocyclic compound binding	probable	GO:0003674, GO:0005488
GO:0055114 [BP]	oxidation-reduction process	probable	GO:0044710, GO:0008150, GO:0008152
GO:0016174 [MF]	NAD(P)H oxidase activity	probable	GO:0003824, GO:0016491, GO:0003674, GO:0016651, GO:0050664
GO:0004128 [MF]	cytochrome-b5 reductase activity, acting on NAD(P)H	probable	GO:0003824, GO:0016491, GO:0003674, GO:0016651, GO:0016653
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0097159 [MF]	organic cyclic compound binding	probable	GO:0003674, GO:0005488
GO:0031967 [CC]	organelle envelope	probable	GO:0005575, GO:0044464, GO:0005623, GO:0031975, GO:0044446, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0048471 [CC]	perinuclear region of cytoplasm	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044238 [BP]	primary metabolic process	probable	GO:0008150, GO:0008152
GO:0006801 [BP]	superoxide metabolic process	probable	GO:0008152, GO:0009987, GO:0008150, GO:0044237, GO:0072593

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
1.-.-.-	Oxidoreductases.	probable
1.6.-.-	Acting on NADH or NADPH.	probable
1.6.2.-	With a heme protein as acceptor.	probable
1.6.2.2	Cytochrome-b5 reductase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1UMK, chain A
Confidence level:very confident
Coverage over the Query: 272-506
View the alignment between query and template
View the model in PyMOL

Template: 3NER, chain A
Confidence level:very confident
Coverage over the Query: 47-127
View the alignment between query and template
View the model in PyMOL

Template: 1WH0, chain A
Confidence level:probable
Coverage over the Query: 170-255
View the alignment between query and template
View the model in PyMOL