Psyllid ID: psy8246
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 527 | 2.2.26 [Sep-21-2011] | |||||||
| Q7L1T6 | 521 | Cytochrome b5 reductase 4 | yes | N/A | 0.802 | 0.811 | 0.366 | 2e-75 | |
| Q502I6 | 527 | Cytochrome b5 reductase 4 | yes | N/A | 0.785 | 0.785 | 0.370 | 2e-75 | |
| Q3TDX8 | 528 | Cytochrome b5 reductase 4 | yes | N/A | 0.802 | 0.801 | 0.376 | 2e-75 | |
| Q32LH7 | 520 | Cytochrome b5 reductase 4 | yes | N/A | 0.796 | 0.807 | 0.367 | 1e-74 | |
| Q68EJ0 | 520 | Cytochrome b5 reductase 4 | yes | N/A | 0.796 | 0.807 | 0.375 | 1e-74 | |
| Q28CZ9 | 523 | Cytochrome b5 reductase 4 | yes | N/A | 0.878 | 0.885 | 0.337 | 1e-69 | |
| Q10352 | 147 | Uncharacterized protein C | yes | N/A | 0.197 | 0.707 | 0.451 | 7e-22 | |
| O74875 | 145 | Uncharacterized heme-bind | no | N/A | 0.187 | 0.682 | 0.464 | 2e-20 | |
| Q54NC1 | 286 | NADH-cytochrome b5 reduct | no | N/A | 0.246 | 0.454 | 0.333 | 5e-15 | |
| A7TNL7 | 285 | NADH-cytochrome b5 reduct | N/A | N/A | 0.252 | 0.466 | 0.323 | 4e-13 |
| >sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 284 bits (726), Expect = 2e-75, Method: Compositional matrix adjust.
Identities = 166/453 (36%), Positives = 247/453 (54%), Gaps = 30/453 (6%)
Query: 6 PNSGGSATGNPRNKTALKPGHSLMDWIRLGNSGVNLSGIQGRIL-VSKAQLAEHNKEDDM 64
P S R+K LK G SLMDWIRL SG +L+G++GR++ V++ +L +HNK+DD
Sbjct: 12 PRSQQRVASGGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGRLIEVTEEELKKHNKKDDC 71
Query: 65 WMCIRGVVYNVTRYMDFHPGGREELMRGAGMDATELFNKVHPWVNYESILQKCIVGKMGS 124
W+CIRG VYNV+ YM++HPGG +ELMR AG D TELF++VH WVNYES+L++C+VG+M
Sbjct: 72 WICIRGFVYNVSPYMEYHPGGEDELMRAAGSDGTELFDQVHRWVNYESMLKECLVGRMAI 131
Query: 125 SLPDENPFVIPSKKSSEPKPLPSINVPVKPFENEKASSNNVSKSFYSMDWFQQLNFICFV 184
P V+ + E K L + +P + A S+ S DWFQ + +
Sbjct: 132 -----KPAVLKDYREEEKKVLNGM-LPKSQVTDTLAKEG---PSYPSYDWFQTDSLVTIA 182
Query: 185 FYLKS---SCPKVLITLNENNTDLSLLINERSLLLH--LEQPVKWPCQVKINLNVGKLQL 239
Y K + +++ ++ +I + L+H L V+ V++ +VGK+++
Sbjct: 183 IYTKQKDINLDSIIVDHQNDSFRAETIIKDCLYLIHIGLSHEVQEDFSVRVVESVGKIEI 242
Query: 240 QLNKEEAKLWKH--HSTKTSTNNITSNSTSSVNIPVSKFNTMRLLHQEQVTHNVVLITLE 297
L K+E W H K + I T + +L+ +E VTH+ L L
Sbjct: 243 VLQKKENTSWDFLGHPLKNHNSLIPRKDTGLY------YRKCQLISKEDVTHDTRLFCLM 296
Query: 298 YTSPMFFYVPVGHHVFIKFIVNDVDISKPYTPV-----EPLQAAPLSYSNTLTFLIKSYE 352
VP+G HV++K + +I KPYTPV + L + + FLIK Y
Sbjct: 297 LPPSTHLQVPIGQHVYLKLPITGTEIVKPYTPVSGSLLSEFKEPVLPNNKYIYFLIKIYP 356
Query: 353 DGLLSPLLCGLREGQELEVSSPEGKFDVGLIGKRNKLVLLAAGTGLTPMIPVINWSIQS- 411
GL +P L L+ G + VSSPEG F + + L LLAAGTG TPM+ ++N+++
Sbjct: 357 TGLFTPELDRLQIGDFVSVSSPEGNFKISKFQELEDLFLLAAGTGFTPMVKILNYALTDI 416
Query: 412 -QRQSVQLVFFNRTEQDIIWRDQLDTFASKNSK 443
+ V+L+FFN+TE DIIWR QL+ A K+ +
Sbjct: 417 PSLRKVKLMFFNKTEDDIIWRSQLEKLAFKDKR 449
|
NADH-cytochrome b5 reductase involved in endoplasmic reticulum stress response pathway. Plays a critical role in protecting pancreatic beta-cells against oxidant stress, possibly by protecting the cell from excess buildup of reactive oxygen species (ROS). Reduces a variety of substrates in vitro, such as cytochrome c, feericyanide and methemoglobin. Homo sapiens (taxid: 9606) EC: 1EC: .EC: 6EC: .EC: 2EC: .EC: 2 |
| >sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 | Back alignment and function description |
|---|
| >sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q54NC1|NCB5R_DICDI NADH-cytochrome b5 reductase 1 OS=Dictyostelium discoideum GN=cyb5r1 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|A7TNL7|NCB5R_VANPO NADH-cytochrome b5 reductase 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CBR1 PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 527 | ||||||
| 193596687 | 474 | PREDICTED: cytochrome b5 reductase 4-lik | 0.728 | 0.810 | 0.433 | 4e-92 | |
| 242015362 | 509 | NADH-cytochrome b5 reductase precursor, | 0.806 | 0.834 | 0.369 | 6e-82 | |
| 348534861 | 518 | PREDICTED: cytochrome b5 reductase 4-lik | 0.776 | 0.789 | 0.368 | 1e-76 | |
| 410959600 | 520 | PREDICTED: cytochrome b5 reductase 4-lik | 0.800 | 0.811 | 0.373 | 1e-75 | |
| 354466438 | 521 | PREDICTED: cytochrome b5 reductase 4-lik | 0.789 | 0.798 | 0.382 | 9e-75 | |
| 354466436 | 520 | PREDICTED: cytochrome b5 reductase 4-lik | 0.783 | 0.794 | 0.387 | 1e-74 | |
| 431838177 | 510 | Cytochrome b5 reductase 4 [Pteropus alec | 0.777 | 0.803 | 0.364 | 1e-74 | |
| 395857953 | 520 | PREDICTED: cytochrome b5 reductase 4-lik | 0.800 | 0.811 | 0.375 | 2e-74 | |
| 345778161 | 519 | PREDICTED: cytochrome b5 reductase 4 [Ca | 0.802 | 0.815 | 0.365 | 2e-74 | |
| 148694570 | 521 | mCG11884, isoform CRA_b [Mus musculus] | 0.802 | 0.811 | 0.374 | 2e-74 |
| >gi|193596687|ref|XP_001948334.1| PREDICTED: cytochrome b5 reductase 4-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 345 bits (885), Expect = 4e-92, Method: Compositional matrix adjust.
Identities = 187/431 (43%), Positives = 268/431 (62%), Gaps = 47/431 (10%)
Query: 12 ATGNPRNKTALKPGHSLMDWIRLGNSGVNLSGIQGRIL-VSKAQLAEHNKEDDMWMCIRG 70
ATG RNK AL PGHSLMDWIRLGNSG +L+G+ G++L +SK++LA+HNK D W+ IRG
Sbjct: 2 ATGTTRNKVALAPGHSLMDWIRLGNSGSDLTGVGGKMLSISKSELAKHNKRTDAWLAIRG 61
Query: 71 VVYNVTRYMDFHPGGREELMRGAGMDATELFNKVHPWVNYESILQKCIVGKMGSSLPDEN 130
VYNVT+YMDFHPGG +EL+RG G DAT+LF+++H WVNYESILQKC+VG+ L +E
Sbjct: 62 TVYNVTQYMDFHPGGVDELVRGIGTDATKLFSEIHAWVNYESILQKCVVGR----LVNEE 117
Query: 131 PFVIPSKKSSEPKPLPSINVPVKPFENEKASSNNVSKSFYSMDWFQQLNFICFVFYLKSS 190
F +P + ++ +VS++ +MDWFQQL F+CFVFY K+
Sbjct: 118 LFKLP---------------------DILKAATDVSENDLNMDWFQQLGFLCFVFYTKTP 156
Query: 191 CPKVLITLNENNTDLSLLINERSLLLHLEQPVKWPCQVKINLNVGKLQLQLNKEEAKLWK 250
P+V ITL + N + ++N ++ + L + V WPC VKI ++GK+Q++L K+ LW
Sbjct: 157 YPEVSITLKQPN-EFRFVLNGKTRCITLHKNVNWPCIVKIVADIGKVQVKLIKKVLGLWP 215
Query: 251 HHSTKTSTNNITSNSTSSVNIPVSKFNTMRLLHQEQVTHNVVLITLEYTSPMFFYVPVGH 310
T ++T NI + + LL VTHN + +Y ++ ++ G
Sbjct: 216 TFGTISTTRNIQID-----------YWKCELLGSFNVTHNTKFLLFKYEQNLYNHIYPGR 264
Query: 311 HVFIKFIVNDVDISKPYTPVEPL----QAAPLSYSNTLTFLIKSYEDGLLSPLLCGLREG 366
H++IK VN +S+PYTPV PL + +S +TL L+KSY +G LS LC L +G
Sbjct: 265 HIYIKANVNGHVVSRPYTPVWPLVETTEYGKIS-EDTLCLLVKSYPNGKLSKHLCSLSQG 323
Query: 367 QELEVSSPEGKFDVGLIGKRNKLVLLAAGTGLTPMIPVINWSIQS--QRQSVQLVFFNRT 424
+EVS P+G F+ + L+LLAAGTG+TPM+P+I ++ S + ++ L+FFN+
Sbjct: 324 DSIEVSRPQGSFECWT--SKTNLILLAAGTGITPMLPIIWNALHSSIKNYNITLLFFNKK 381
Query: 425 EQDIIWRDQLD 435
E IIW+ LD
Sbjct: 382 ETCIIWKKYLD 392
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242015362|ref|XP_002428328.1| NADH-cytochrome b5 reductase precursor, putative [Pediculus humanus corporis] gi|212512924|gb|EEB15590.1| NADH-cytochrome b5 reductase precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|348534861|ref|XP_003454920.1| PREDICTED: cytochrome b5 reductase 4-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|410959600|ref|XP_003986393.1| PREDICTED: cytochrome b5 reductase 4-like [Felis catus] | Back alignment and taxonomy information |
|---|
| >gi|354466438|ref|XP_003495681.1| PREDICTED: cytochrome b5 reductase 4-like isoform 2 [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
| >gi|354466436|ref|XP_003495680.1| PREDICTED: cytochrome b5 reductase 4-like isoform 1 [Cricetulus griseus] gi|344238409|gb|EGV94512.1| Cytochrome b5 reductase 4 [Cricetulus griseus] | Back alignment and taxonomy information |
|---|
| >gi|431838177|gb|ELK00109.1| Cytochrome b5 reductase 4 [Pteropus alecto] | Back alignment and taxonomy information |
|---|
| >gi|395857953|ref|XP_003801344.1| PREDICTED: cytochrome b5 reductase 4-like [Otolemur garnettii] | Back alignment and taxonomy information |
|---|
| >gi|345778161|ref|XP_532219.3| PREDICTED: cytochrome b5 reductase 4 [Canis lupus familiaris] | Back alignment and taxonomy information |
|---|
| >gi|148694570|gb|EDL26517.1| mCG11884, isoform CRA_b [Mus musculus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 527 | ||||||
| MGI|MGI:2386848 | 528 | Cyb5r4 "cytochrome b5 reductas | 0.800 | 0.799 | 0.361 | 2.8e-66 | |
| UNIPROTKB|E2R102 | 519 | CYB5R4 "Uncharacterized protei | 0.795 | 0.807 | 0.343 | 2.5e-65 | |
| ZFIN|ZDB-GENE-050522-225 | 527 | cyb5r4 "cytochrome b5 reductas | 0.785 | 0.785 | 0.358 | 4.1e-65 | |
| UNIPROTKB|Q7L1T6 | 521 | CYB5R4 "Cytochrome b5 reductas | 0.796 | 0.806 | 0.352 | 5.2e-65 | |
| UNIPROTKB|Q32LH7 | 520 | CYB5R4 "Cytochrome b5 reductas | 0.795 | 0.805 | 0.349 | 2.9e-64 | |
| UNIPROTKB|E1BS19 | 523 | CYB5R4 "Uncharacterized protei | 0.796 | 0.803 | 0.341 | 7.6e-64 | |
| FB|FBgn0034442 | 535 | CG11257 [Drosophila melanogast | 0.220 | 0.216 | 0.675 | 2.6e-63 | |
| UNIPROTKB|F1MB85 | 520 | CYB5R4 "Cytochrome b5 reductas | 0.795 | 0.805 | 0.343 | 9e-61 | |
| WB|WBGene00013123 | 552 | Y52B11A.3 [Caenorhabditis eleg | 0.370 | 0.353 | 0.365 | 1.9e-41 | |
| RGD|621834 | 520 | Cyb5r4 "cytochrome b5 reductas | 0.445 | 0.451 | 0.354 | 1.3e-36 |
| MGI|MGI:2386848 Cyb5r4 "cytochrome b5 reductase 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Score = 674 (242.3 bits), Expect = 2.8e-66, P = 2.8e-66
Identities = 163/451 (36%), Positives = 235/451 (52%)
Query: 6 PNSGGSATGNPRNKTALKPGHSLMDWIRLGNSGVNLSGIQGRIL-VSKAQLAEHNKEDDM 64
P S + R+K LK G SLMDWIRL SG +L+G++G ++ V++ +L +HNK++D
Sbjct: 12 PGSQQRVSSQGRSKVPLKQGRSLMDWIRLTKSGKDLTGLKGGLIEVTEEELKKHNKKEDC 71
Query: 65 WMCIRGVVYNVTRYMDFHPGGREELMRGAGMDATELFNKVHPWVNYESILQKCIVGKMG- 123
W+CIRG VYNV+ YM++HPGG +ELMR AG D T+LFN+VH WVNYES+L++C+VG+M
Sbjct: 72 WICIRGFVYNVSPYMEYHPGGEDELMRAAGADGTDLFNEVHRWVNYESMLKECLVGRMAV 131
Query: 124 -SSLPD---ENPFVIXXXXXXXXXXXXXINVPVKPFENEKASSNNVSKSFYSMDWFQQLN 179
++P E V+ E SS S DWFQ +
Sbjct: 132 KPAVPKDCHEGKRVLNGMLPKSQMSDTLPRDVTDTLPREDLSSP-------SYDWFQTES 184
Query: 180 FICFVFYLKS---SCPKVLITLNENN--TDXXXXXXXXXXXXXXXQPVKWPCQVKINLNV 234
+ V Y K S V++ L +++ + V+ V++ NV
Sbjct: 185 SVTIVVYTKQKNISLDSVIVDLQDDSLRAEAVIKDHSYLVHVGLSHEVQENFSVRVIENV 244
Query: 235 GKLQLQLNKEEAKLWKHHXXXXXXXXXXXXXXXXXXXXXXKFNTMRLLHQEQVTHNVVLI 294
GK+++ L K+E+ W+ + +L+ +E VTH+ L
Sbjct: 245 GKIEIVLQKKESVSWQ----CLGDHLEKHDSFIPKKDTGLYYRRCQLISKEDVTHDTRLF 300
Query: 295 TLEYTSPMFFYVPVGHHVFIKFIVNDVDISKPYTPVEP-----LQAAPLSYSNTLTFLIK 349
L VPVG HV++K V +I KPYTPV + LS + + FLIK
Sbjct: 301 CLMLPPSTHLQVPVGQHVYLKLSVTGAEIVKPYTPVSDSLLSDFKEPVLSPNKYICFLIK 360
Query: 350 SYEDGLLSPLLCGLREGQELEVSSPEGKFDVGLIGKRNKLVLLAAGTGLTPMIPVINWSI 409
Y GL +P L L+ G + VS PEG F V + + L LLAAGTG TPM+ V+N+++
Sbjct: 361 IYPAGLFTPELDRLQIGDFISVSGPEGDFKVSKLQEVEDLFLLAAGTGFTPMVTVLNYAL 420
Query: 410 Q--SQRQSVQLVFFNRTEQDIIWRDQLDTFA 438
S + V+L+FFN+TE DIIWR QL+ A
Sbjct: 421 SHMSSLRKVKLMFFNKTEDDIIWRCQLEKLA 451
|
|
| UNIPROTKB|E2R102 CYB5R4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050522-225 cyb5r4 "cytochrome b5 reductase 4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q7L1T6 CYB5R4 "Cytochrome b5 reductase 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32LH7 CYB5R4 "Cytochrome b5 reductase 4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BS19 CYB5R4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0034442 CG11257 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MB85 CYB5R4 "Cytochrome b5 reductase 4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00013123 Y52B11A.3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|621834 Cyb5r4 "cytochrome b5 reductase 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| Q68EJ0 | NB5R4_RAT | 1, ., 6, ., 2, ., 2 | 0.3758 | 0.7969 | 0.8076 | yes | N/A |
| Q28CZ9 | NB5R4_XENTR | 1, ., 6, ., 2, ., 2 | 0.3373 | 0.8785 | 0.8852 | yes | N/A |
| Q7L1T6 | NB5R4_HUMAN | 1, ., 6, ., 2, ., 2 | 0.3664 | 0.8026 | 0.8119 | yes | N/A |
| Q32LH7 | NB5R4_BOVIN | 1, ., 6, ., 2, ., 2 | 0.3670 | 0.7969 | 0.8076 | yes | N/A |
| Q3TDX8 | NB5R4_MOUSE | 1, ., 6, ., 2, ., 2 | 0.3760 | 0.8026 | 0.8011 | yes | N/A |
| Q502I6 | NB5R4_DANRE | 1, ., 6, ., 2, ., 2 | 0.3708 | 0.7855 | 0.7855 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 1.6.2 | 0.766 |
| 4th Layer | 1.6.2.2 | 0.824 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 527 | |||
| cd06183 | 234 | cd06183, cyt_b5_reduct_like, Cytochrome b5 reducta | 1e-38 | |
| pfam00173 | 74 | pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid | 2e-24 | |
| COG1018 | 266 | COG1018, Hmp, Flavodoxin reductases (ferredoxin-NA | 1e-22 | |
| COG5274 | 164 | COG5274, CYB5, Cytochrome b involved in lipid meta | 9e-20 | |
| cd06215 | 231 | cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur bi | 2e-19 | |
| cd06214 | 241 | cd06214, PA_degradation_oxidoreductase_like, NAD(P | 1e-18 | |
| COG0543 | 252 | COG0543, UbiB, 2-polyprenylphenol hydroxylase and | 4e-16 | |
| cd00322 | 223 | cd00322, FNR_like, Ferredoxin reductase (FNR), an | 5e-16 | |
| cd06490 | 87 | cd06490, p23_NCB5OR, p23_like domain found in NAD( | 2e-15 | |
| cd06216 | 243 | cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur bi | 7e-15 | |
| pfam00970 | 99 | pfam00970, FAD_binding_6, Oxidoreductase FAD-bindi | 2e-14 | |
| cd06191 | 231 | cd06191, FNR_iron_sulfur_binding, Iron-sulfur bind | 7e-14 | |
| TIGR02160 | 352 | TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenas | 2e-13 | |
| PLN02252 | 888 | PLN02252, PLN02252, nitrate reductase [NADPH] | 5e-13 | |
| PLN02252 | 888 | PLN02252, PLN02252, nitrate reductase [NADPH] | 1e-11 | |
| cd06187 | 224 | cd06187, O2ase_reductase_like, The oxygenase reduc | 1e-11 | |
| PTZ00319 | 300 | PTZ00319, PTZ00319, NADH-cytochrome B5 reductase; | 4e-11 | |
| cd06196 | 218 | cd06196, FNR_like_1, Ferredoxin reductase-like pro | 7e-11 | |
| cd06217 | 235 | cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur bi | 3e-10 | |
| cd06212 | 232 | cd06212, monooxygenase_like, The oxygenase reducta | 5e-10 | |
| cd06213 | 227 | cd06213, oxygenase_e_transfer_subunit, The oxygena | 2e-09 | |
| cd06184 | 247 | cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P) | 2e-08 | |
| cd06195 | 241 | cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase i | 6e-08 | |
| cd06209 | 228 | cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reduc | 7e-08 | |
| cd06198 | 216 | cd06198, FNR_like_3, NAD(P) binding domain of ferr | 9e-08 | |
| cd06190 | 232 | cd06190, T4MO_e_transfer_like, Toluene-4-monoxygen | 2e-07 | |
| COG4097 | 438 | COG4097, COG4097, Predicted ferric reductase [Inor | 3e-07 | |
| pfam00175 | 106 | pfam00175, NAD_binding_1, Oxidoreductase NAD-bindi | 3e-07 | |
| cd06466 | 84 | cd06466, p23_CS_SGT1_like, p23_like domain similar | 7e-07 | |
| cd06194 | 222 | cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulf | 4e-06 | |
| cd06186 | 210 | cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NO | 1e-05 | |
| cd06189 | 224 | cd06189, flavin_oxioreductase, NAD(P)H dependent f | 4e-05 | |
| cd06221 | 253 | cd06221, sulfite_reductase_like, Anaerobic sulfite | 6e-05 | |
| PRK11872 | 340 | PRK11872, antC, anthranilate dioxygenase reductase | 7e-05 | |
| PLN03198 | 526 | PLN03198, PLN03198, delta6-acyl-lipid desaturase; | 1e-04 | |
| PRK10684 | 332 | PRK10684, PRK10684, HCP oxidoreductase, NADH-depen | 1e-04 | |
| cd06185 | 211 | cd06185, PDR_like, Phthalate dioxygenase reductase | 2e-04 | |
| PTZ00274 | 325 | PTZ00274, PTZ00274, cytochrome b5 reductase; Provi | 3e-04 | |
| cd06220 | 233 | cd06220, DHOD_e_trans_like2, FAD/NAD binding domai | 5e-04 | |
| cd06218 | 246 | cd06218, DHOD_e_trans, FAD/NAD binding domain in t | 8e-04 | |
| cd06211 | 238 | cd06211, phenol_2-monooxygenase_like, Phenol 2-mon | 0.002 | |
| cd06192 | 243 | cd06192, DHOD_e_trans_like, FAD/NAD binding domain | 0.002 |
| >gnl|CDD|99780 cd06183, cyt_b5_reduct_like, Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor | Back alignment and domain information |
|---|
Score = 141 bits (357), Expect = 1e-38
Identities = 54/168 (32%), Positives = 88/168 (52%), Gaps = 10/168 (5%)
Query: 280 RLLHQEQVTHNVVLITLEYTSPMF-FYVPVGHHVFIKFIVNDVDISKPYTPVEPLQAAPL 338
+L+ +E ++H+ + E SP +PVG HV +K + + +PYTP+ P
Sbjct: 2 KLVSKEDISHDTRIFRFELPSPDQVLGLPVGQHVELKAPDDGEQVVRPYTPISPDDD--- 58
Query: 339 SYSNTLTFLIKSYEDGLLSPLLCGLREGQELEVSSPEGKFDVGLIGKRNKLVLLAAGTGL 398
LIK Y G +S L L+ G +E+ P GKF+ GK + ++A GTG+
Sbjct: 59 --KGYFDLLIKIYPGGKMSQYLHSLKPGDTVEIRGPFGKFEYKPNGKVKHIGMIAGGTGI 116
Query: 399 TPMIPVINWSIQSQRQ---SVQLVFFNRTEQDIIWRDQLDTFASKNSK 443
TPM+ +I +I + + L++ NRTE+DI+ R++LD A K+
Sbjct: 117 TPMLQLIR-AILKDPEDKTKISLLYANRTEEDILLREELDELAKKHPD 163
|
Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH. Length = 234 |
| >gnl|CDD|201057 pfam00173, Cyt-b5, Cytochrome b5-like Heme/Steroid binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|223949 COG1018, Hmp, Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|227599 COG5274, CYB5, Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|99811 cd06215, FNR_iron_sulfur_binding_1, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|99810 cd06214, PA_degradation_oxidoreductase_like, NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|223617 COG0543, UbiB, 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|99778 cd00322, FNR_like, Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I | Back alignment and domain information |
|---|
| >gnl|CDD|107240 cd06490, p23_NCB5OR, p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|99812 cd06216, FNR_iron_sulfur_binding_2, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|216220 pfam00970, FAD_binding_6, Oxidoreductase FAD-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99788 cd06191, FNR_iron_sulfur_binding, Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|131215 TIGR02160, PA_CoA_Oxy5, phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >gnl|CDD|215141 PLN02252, PLN02252, nitrate reductase [NADPH] | Back alignment and domain information |
|---|
| >gnl|CDD|99784 cd06187, O2ase_reductase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant | Back alignment and domain information |
|---|
| >gnl|CDD|173521 PTZ00319, PTZ00319, NADH-cytochrome B5 reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99793 cd06196, FNR_like_1, Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99813 cd06217, FNR_iron_sulfur_binding_3, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|99808 cd06212, monooxygenase_like, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >gnl|CDD|99809 cd06213, oxygenase_e_transfer_subunit, The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >gnl|CDD|99781 cd06184, flavohem_like_fad_nad_binding, FAD_NAD(P)H binding domain of flavohemoglobin | Back alignment and domain information |
|---|
| >gnl|CDD|99792 cd06195, FNR1, Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin | Back alignment and domain information |
|---|
| >gnl|CDD|99805 cd06209, BenDO_FAD_NAD, Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99795 cd06198, FNR_like_3, NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|99787 cd06190, T4MO_e_transfer_like, Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system | Back alignment and domain information |
|---|
| >gnl|CDD|226582 COG4097, COG4097, Predicted ferric reductase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215769 pfam00175, NAD_binding_1, Oxidoreductase NAD-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|107223 cd06466, p23_CS_SGT1_like, p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) | Back alignment and domain information |
|---|
| >gnl|CDD|99791 cd06194, FNR_N-term_Iron_sulfur_binding, Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain | Back alignment and domain information |
|---|
| >gnl|CDD|99783 cd06186, NOX_Duox_like_FAD_NADP, NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide | Back alignment and domain information |
|---|
| >gnl|CDD|99786 cd06189, flavin_oxioreductase, NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins | Back alignment and domain information |
|---|
| >gnl|CDD|99817 cd06221, sulfite_reductase_like, Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|183350 PRK11872, antC, anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178739 PLN03198, PLN03198, delta6-acyl-lipid desaturase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236735 PRK10684, PRK10684, HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99782 cd06185, PDR_like, Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster | Back alignment and domain information |
|---|
| >gnl|CDD|140300 PTZ00274, PTZ00274, cytochrome b5 reductase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|99816 cd06220, DHOD_e_trans_like2, FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|99814 cd06218, DHOD_e_trans, FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|99807 cd06211, phenol_2-monooxygenase_like, Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol | Back alignment and domain information |
|---|
| >gnl|CDD|99789 cd06192, DHOD_e_trans_like, FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 527 | |||
| PLN02252 | 888 | nitrate reductase [NADPH] | 100.0 | |
| KOG0534|consensus | 286 | 100.0 | ||
| cd06188 | 283 | NADH_quinone_reductase Na+-translocating NADH:quin | 100.0 | |
| PRK10926 | 248 | ferredoxin-NADP reductase; Provisional | 100.0 | |
| cd06217 | 235 | FNR_iron_sulfur_binding_3 Iron-sulfur binding ferr | 100.0 | |
| cd06184 | 247 | flavohem_like_fad_nad_binding FAD_NAD(P)H binding | 100.0 | |
| COG1018 | 266 | Hmp Flavodoxin reductases (ferredoxin-NADPH reduct | 100.0 | |
| cd06211 | 238 | phenol_2-monooxygenase_like Phenol 2-monooxygenase | 100.0 | |
| PRK11872 | 340 | antC anthranilate dioxygenase reductase; Provision | 100.0 | |
| cd06191 | 231 | FNR_iron_sulfur_binding Iron-sulfur binding Ferred | 100.0 | |
| PRK10684 | 332 | HCP oxidoreductase, NADH-dependent; Provisional | 100.0 | |
| PTZ00274 | 325 | cytochrome b5 reductase; Provisional | 100.0 | |
| PRK13289 | 399 | bifunctional nitric oxide dioxygenase/dihydropteri | 100.0 | |
| cd06210 | 236 | MMO_FAD_NAD_binding Methane monooxygenase (MMO) re | 100.0 | |
| cd06195 | 241 | FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-c | 100.0 | |
| cd06215 | 231 | FNR_iron_sulfur_binding_1 Iron-sulfur binding ferr | 100.0 | |
| cd06189 | 224 | flavin_oxioreductase NAD(P)H dependent flavin oxid | 100.0 | |
| cd06209 | 228 | BenDO_FAD_NAD Benzoate dioxygenase reductase (BenD | 100.0 | |
| PRK07609 | 339 | CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat | 100.0 | |
| cd06212 | 232 | monooxygenase_like The oxygenase reductase FAD/NAD | 100.0 | |
| TIGR02160 | 352 | PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, | 100.0 | |
| PTZ00319 | 300 | NADH-cytochrome B5 reductase; Provisional | 100.0 | |
| cd06216 | 243 | FNR_iron_sulfur_binding_2 Iron-sulfur binding ferr | 100.0 | |
| cd06214 | 241 | PA_degradation_oxidoreductase_like NAD(P) binding | 100.0 | |
| cd06196 | 218 | FNR_like_1 Ferredoxin reductase-like proteins cata | 100.0 | |
| cd00322 | 223 | FNR_like Ferredoxin reductase (FNR), an FAD and NA | 100.0 | |
| cd06213 | 227 | oxygenase_e_transfer_subunit The oxygenase reducta | 100.0 | |
| PRK05464 | 409 | Na(+)-translocating NADH-quinone reductase subunit | 100.0 | |
| PRK08051 | 232 | fre FMN reductase; Validated | 100.0 | |
| cd06190 | 232 | T4MO_e_transfer_like Toluene-4-monoxygenase electr | 100.0 | |
| TIGR01941 | 405 | nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo | 100.0 | |
| cd06187 | 224 | O2ase_reductase_like The oxygenase reductase FAD/N | 100.0 | |
| cd06208 | 286 | CYPOR_like_FNR These ferredoxin reductases are rel | 100.0 | |
| cd06183 | 234 | cyt_b5_reduct_like Cytochrome b5 reductase catalyz | 100.0 | |
| PRK05713 | 312 | hypothetical protein; Provisional | 100.0 | |
| PRK08345 | 289 | cytochrome-c3 hydrogenase subunit gamma; Provision | 100.0 | |
| PLN03116 | 307 | ferredoxin--NADP+ reductase; Provisional | 100.0 | |
| cd06194 | 222 | FNR_N-term_Iron_sulfur_binding Iron-sulfur binding | 99.98 | |
| PLN03115 | 367 | ferredoxin--NADP(+) reductase; Provisional | 99.98 | |
| cd06201 | 289 | SiR_like2 Cytochrome p450- like alpha subunits of | 99.97 | |
| KOG0536|consensus | 145 | 99.97 | ||
| cd06221 | 253 | sulfite_reductase_like Anaerobic sulfite reductase | 99.97 | |
| cd06198 | 216 | FNR_like_3 NAD(P) binding domain of ferredoxin red | 99.97 | |
| COG0543 | 252 | UbiB 2-polyprenylphenol hydroxylase and related fl | 99.97 | |
| cd06182 | 267 | CYPOR_like NADPH cytochrome p450 reductase (CYPOR) | 99.97 | |
| PRK08221 | 263 | anaerobic sulfite reductase subunit B; Provisional | 99.97 | |
| cd06192 | 243 | DHOD_e_trans_like FAD/NAD binding domain (electron | 99.97 | |
| TIGR03224 | 411 | benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p | 99.97 | |
| TIGR02911 | 261 | sulfite_red_B sulfite reductase, subunit B. Member | 99.97 | |
| cd06185 | 211 | PDR_like Phthalate dioxygenase reductase (PDR) is | 99.97 | |
| PRK05802 | 320 | hypothetical protein; Provisional | 99.97 | |
| cd06218 | 246 | DHOD_e_trans FAD/NAD binding domain in the electro | 99.96 | |
| PRK06222 | 281 | ferredoxin-NADP(+) reductase subunit alpha; Review | 99.96 | |
| cd06219 | 248 | DHOD_e_trans_like1 FAD/NAD binding domain in the e | 99.96 | |
| cd06197 | 220 | FNR_like_2 FAD/NAD(P) binding domain of ferredoxin | 99.96 | |
| cd06200 | 245 | SiR_like1 Cytochrome p450- like alpha subunits of | 99.96 | |
| PRK00054 | 250 | dihydroorotate dehydrogenase electron transfer sub | 99.96 | |
| PTZ00306 | 1167 | NADH-dependent fumarate reductase; Provisional | 99.96 | |
| COG4097 | 438 | Predicted ferric reductase [Inorganic ion transpor | 99.96 | |
| cd06220 | 233 | DHOD_e_trans_like2 FAD/NAD binding domain in the e | 99.95 | |
| cd06193 | 235 | siderophore_interacting Siderophore interacting pr | 99.94 | |
| PRK12778 | 752 | putative bifunctional 2-polyprenylphenol hydroxyla | 99.93 | |
| PRK12779 | 944 | putative bifunctional glutamate synthase subunit b | 99.93 | |
| COG2871 | 410 | NqrF Na+-transporting NADH:ubiquinone oxidoreducta | 99.92 | |
| cd06186 | 210 | NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyz | 99.92 | |
| cd06207 | 382 | CyPoR_like NADPH cytochrome p450 reductase (CYPOR) | 99.91 | |
| PRK12775 | 1006 | putative trifunctional 2-polyprenylphenol hydroxyl | 99.9 | |
| cd06199 | 360 | SiR Cytochrome p450- like alpha subunits of E. col | 99.9 | |
| KOG0537|consensus | 124 | 99.89 | ||
| TIGR01931 | 597 | cysJ sulfite reductase [NADPH] flavoprotein, alpha | 99.88 | |
| cd06206 | 384 | bifunctional_CYPOR These bifunctional proteins fus | 99.88 | |
| cd06202 | 406 | Nitric_oxide_synthase The ferredoxin-reductase (FN | 99.87 | |
| cd06203 | 398 | methionine_synthase_red Human methionine synthase | 99.87 | |
| PLN02292 | 702 | ferric-chelate reductase | 99.87 | |
| cd06204 | 416 | CYPOR NADPH cytochrome p450 reductase (CYPOR) serv | 99.86 | |
| PRK10953 | 600 | cysJ sulfite reductase subunit alpha; Provisional | 99.85 | |
| PRK06214 | 530 | sulfite reductase; Provisional | 99.84 | |
| PLN02631 | 699 | ferric-chelate reductase | 99.82 | |
| PLN02844 | 722 | oxidoreductase/ferric-chelate reductase | 99.81 | |
| PF00970 | 99 | FAD_binding_6: Oxidoreductase FAD-binding domain; | 99.8 | |
| KOG3378|consensus | 385 | 99.79 | ||
| PF00173 | 76 | Cyt-b5: Cytochrome b5-like Heme/Steroid binding do | 99.77 | |
| COG5274 | 164 | CYB5 Cytochrome b involved in lipid metabolism [En | 99.76 | |
| COG0369 | 587 | CysJ Sulfite reductase, alpha subunit (flavoprotei | 99.76 | |
| PF00175 | 109 | NAD_binding_1: Oxidoreductase NAD-binding domain ; | 99.74 | |
| KOG1158|consensus | 645 | 99.66 | ||
| KOG0039|consensus | 646 | 99.64 | ||
| PLN03199 | 485 | delta6-acyl-lipid desaturase-like protein; Provisi | 99.61 | |
| PLN03198 | 526 | delta6-acyl-lipid desaturase; Provisional | 99.59 | |
| PRK06567 | 1028 | putative bifunctional glutamate synthase subunit b | 99.52 | |
| KOG1159|consensus | 574 | 99.5 | ||
| PF08030 | 156 | NAD_binding_6: Ferric reductase NAD binding domain | 99.31 | |
| KOG4232|consensus | 430 | 99.26 | ||
| COG2375 | 265 | ViuB Siderophore-interacting protein [Inorganic io | 99.22 | |
| KOG4576|consensus | 167 | 99.17 | ||
| PF08022 | 105 | FAD_binding_8: FAD-binding domain; InterPro: IPR01 | 98.88 | |
| PF08021 | 117 | FAD_binding_9: Siderophore-interacting FAD-binding | 98.79 | |
| cd06490 | 87 | p23_NCB5OR p23_like domain found in NAD(P)H cytoch | 98.67 | |
| COG4892 | 81 | Predicted heme/steroid binding protein [General fu | 98.48 | |
| cd06488 | 87 | p23_melusin_like p23_like domain similar to the C- | 97.7 | |
| KOG1110|consensus | 183 | 96.88 | ||
| cd06466 | 84 | p23_CS_SGT1_like p23_like domain similar to the C- | 96.86 | |
| PLN03088 | 356 | SGT1, suppressor of G2 allele of SKP1; Provisional | 96.82 | |
| cd06489 | 84 | p23_CS_hSgt1_like p23_like domain similar to the C | 96.52 | |
| KOG1309|consensus | 196 | 95.53 | ||
| KOG1108|consensus | 281 | 94.83 | ||
| cd06465 | 108 | p23_hB-ind1_like p23_like domain found in human (h | 93.69 | |
| cd06468 | 92 | p23_CacyBP p23_like domain found in proteins simil | 93.55 | |
| PF04969 | 79 | CS: CS domain; InterPro: IPR017447 The function of | 93.53 | |
| cd06463 | 84 | p23_like Proteins containing this p23_like domain | 93.48 | |
| KOG1667|consensus | 320 | 92.59 | ||
| cd06469 | 78 | p23_DYX1C1_like p23_like domain found in proteins | 91.11 | |
| cd06467 | 85 | p23_NUDC_like p23_like domain of NUD (nuclear dist | 87.12 | |
| cd06493 | 85 | p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear | 81.53 |
| >PLN02252 nitrate reductase [NADPH] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1e-54 Score=491.12 Aligned_cols=371 Identities=24% Similarity=0.364 Sum_probs=275.7
Q ss_pred CCCCCccccCCCCCCcchhh-hhccCCC------CCCC----C----CCCcc-cCHHHHhcccCCCCeEEEEcCEEEecc
Q psy8246 13 TGNPRNKTALKPGHSLMDWI-RLGNSGV------NLSG----I----QGRIL-VSKAQLAEHNKEDDMWMCIRGVVYNVT 76 (527)
Q Consensus 13 ~~~~~~~~~~~~g~~~~~w~-~~~~~~~------~~~~----~----~~~~~-~t~~e~~~h~~~~~~wvii~g~VYDvt 76 (527)
..+-||+||++||...+||| +..+.+. .+.. . .+..+ |+++|+++|++.++|||+|+|+|||+|
T Consensus 467 ~~~~~f~hp~~~~~~~ggwm~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~t~~ev~~h~~~~~~Wivi~g~VYDvT 546 (888)
T PLN02252 467 EIGLVFEHPTQPGNQSGGWMAKQKHLETASAAAPALKKSVSTPFMNTNTGSKQYTMSEVRKHNSEDSCWIVVHGHVYDCT 546 (888)
T ss_pred cceEEEeCCCCccCCCCCcchhhhhcccccccccccccccCCcccCCccccceeCHHHHHhhCcCCCeEEEECCEEEeCH
Confidence 44569999999999999999 5444220 1110 0 11224 999999999999999999999999999
Q ss_pred cCcccccccccccccccccccchhhhccCCchhHHHhhhcCeeeEeCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCc
Q psy8246 77 RYMDFHPGGREELMRGAGMDATELFNKVHPWVNYESILQKCIVGKMGSSLPDENPFVIPSKKSSEPKPLPSINVPVKPFE 156 (527)
Q Consensus 77 ~f~~~HPGG~~~l~~~aG~D~T~~f~~~h~~~~~~~~l~~~~vG~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 156 (527)
+|+..||||.++|+.++|+|+|++|+++|+. .+++||++|+||+|............ ..... ..
T Consensus 547 ~fl~~HPGG~~~I~~~aG~DaT~~F~~~Hs~-~a~~~L~~~~IG~l~~~~~~~~~~~~---~~~~~------------~~ 610 (888)
T PLN02252 547 RFLKDHPGGADSILINAGTDCTEEFDAIHSD-KAKKMLEDYRIGELVTTGAAASSSAS---SHPLS------------AI 610 (888)
T ss_pred HHHHHCCChHHHHHhhcCCCcHHHHhhhhhH-HHHHHHHhCcCCcccccccccccccc---ccccc------------cc
Confidence 9999999999999999999999999999874 67789999999999866543221000 00000 00
Q ss_pred ccccccCCCCCCCCccceEeecCcEEEEEEeccCCCceEEecCCCceEEEEEEcCeeeeeeccCCcccceeEEEeeeeeE
Q psy8246 157 NEKASSNNVSKSFYSMDWFQQLNFICFVFYLKSSCPKVLITLNENNTDLSLLINERSLLLHLEQPVKWPCQVKINLNVGK 236 (527)
Q Consensus 157 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~ 236 (527)
. .. ..+ . .... . ..
T Consensus 611 ~------~~--~~~-----------------------------------------------~-~~~~--------~--~~ 624 (888)
T PLN02252 611 S------TA--SAL-----------------------------------------------A-AASP--------A--PG 624 (888)
T ss_pred c------cc--ccc-----------------------------------------------c-cccC--------C--cc
Confidence 0 00 000 0 0000 0 00
Q ss_pred EEEEEcccccccccccCcccccCCcCCCCcccccCCCCceEEEEEEEEEEecCCEEEEEEEeCCCcC-cccCCccEEEEE
Q psy8246 237 LQLQLNKEEAKLWKHHSTKTSTNNITSNSTSSVNIPVSKFNTMRLLHQEQVTHNVVLITLEYTSPMF-FYVPVGHHVFIK 315 (527)
Q Consensus 237 ~~~~l~~~~~~~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~vs~d~~~~~~~~p~~~~-~~~~pGQ~v~l~ 315 (527)
..++| .+..|.+++|++++.+++|++.|+|+++.... +.+++||||+|+
T Consensus 625 ~~~~l------------------------------~p~~~~~~~Lv~k~~lS~d~~~f~f~lp~~~~~lgl~pGQhV~l~ 674 (888)
T PLN02252 625 RPVAL------------------------------NPREKIPCRLVEKISLSHDVRLFRFALPSEDHVLGLPVGKHVFLC 674 (888)
T ss_pred ccccc------------------------------ccCceEEEEEEEEEEccCCeEEEEEEECCCcccCCCCCCCEEEEE
Confidence 01112 22346789999999999999999999987643 469999999999
Q ss_pred EEeCCeeeeeeeeccCCCCCCCCCCCCEEEEEEEEe---------CCCCchHhhhcCCCCCEEEEeccccccccC-----
Q psy8246 316 FIVNDVDISKPYTPVEPLQAAPLSYSNTLTFLIKSY---------EDGLLSPLLCGLREGQELEVSSPEGKFDVG----- 381 (527)
Q Consensus 316 ~~~~g~~~~R~YT~~s~~~~~~~~~~~~l~l~IK~y---------~~G~~S~~L~~l~~Gd~v~i~GP~G~f~~~----- 381 (527)
+...|..+.|+|||++.+. +.+.|+|+||+| ++|.+|++|++|++||+|+|+||+|.|.+.
T Consensus 675 ~~~~g~~~~R~YSpaS~~~-----~~g~lel~VK~~~~~~~~~~p~gG~~S~~L~~L~vGd~V~V~GP~G~f~y~g~G~f 749 (888)
T PLN02252 675 ATINGKLCMRAYTPTSSDD-----EVGHFELVIKVYFKNVHPKFPNGGLMSQYLDSLPIGDTIDVKGPLGHIEYAGRGSF 749 (888)
T ss_pred EecCCeEEEeeeEecccCC-----CCCEEEEEEEEEeccccCccCCCCchhhHHhcCCCCCEEEEecCccceeeccccee
Confidence 9877888899999999763 578999999999 579999999999999999999999987542
Q ss_pred ---C-CCCCccEEEEEecCCchhHHHHHHHHHHhC--CCcEEEEEEeCCCchhhhHHHHHHHHhcC-CCCeEeccCCCCC
Q psy8246 382 ---L-IGKRNKLVLLAAGTGLTPMIPVINWSIQSQ--RQSVQLVFFNRTEQDIIWRDQLDTFASKN-SKPSSPRNPSTEI 454 (527)
Q Consensus 382 ---~-~~~~~~ivlIAgGtGItP~l~ll~~l~~~~--~~~v~L~~~~r~~~di~~~~eL~~l~~~~-~~~~~~~~~s~~~ 454 (527)
. ....++++|||||||||||++||+++++.. .++|+|+|++|+++|++|++||++|++++ ++|++....++..
T Consensus 750 ~l~~~~~~~~~vvmIAGGsGITPi~silr~ll~~~~d~t~i~Liyg~Rt~~Dil~~eEL~~la~~~p~~~~v~~vls~~~ 829 (888)
T PLN02252 750 LVNGKPKFAKKLAMLAGGTGITPMYQVIQAILRDPEDKTEMSLVYANRTEDDILLREELDRWAAEHPDRLKVWYVVSQVK 829 (888)
T ss_pred eeccccccCceEEEEecceehhHHHHHHHHHHhccCCCCcEEEEEEECCHHHhhHHHHHHHHHHhCCCCEEEEEEecCCC
Confidence 1 123579999999999999999999998764 57999999999999999999999999876 6888876655422
Q ss_pred CcccccccccchhhhhhchhHHHhhhcC--CCcEEEEcCchHHHH-HHHHHHHHh
Q psy8246 455 KPLKNIISFLMRIRTTLKRVELEDLLNS--NSLVYSQLNLPYAVA-AVADKMTGM 506 (527)
Q Consensus 455 ~~~~g~~~~~~ri~~~~~~~~l~~l~~~--~~~~~yiCGPp~m~~-~v~~~L~~l 506 (527)
. .+.....+++...+ +++++.. ....+|+|||++|++ ++...|+++
T Consensus 830 ~--~~w~g~~GrV~~~l----l~~~l~~~~~~~~vyiCGPp~Mi~~av~~~L~~~ 878 (888)
T PLN02252 830 R--EGWKYSVGRVTEAM----LREHLPEGGDETLALMCGPPPMIEFACQPNLEKM 878 (888)
T ss_pred c--CCCCCcCCcCCHHH----HHHhcccCCCCeEEEEeCCHHHHHHHHHHHHHHc
Confidence 0 01111234443322 3333321 245688999999999 578888876
|
|
| >KOG0534|consensus | Back alignment and domain information |
|---|
| >cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain | Back alignment and domain information |
|---|
| >PRK10926 ferredoxin-NADP reductase; Provisional | Back alignment and domain information |
|---|
| >cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin | Back alignment and domain information |
|---|
| >COG1018 Hmp Flavodoxin reductases (ferredoxin-NADPH reductases) family 1 [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol | Back alignment and domain information |
|---|
| >PRK11872 antC anthranilate dioxygenase reductase; Provisional | Back alignment and domain information |
|---|
| >cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >PRK10684 HCP oxidoreductase, NADH-dependent; Provisional | Back alignment and domain information |
|---|
| >PTZ00274 cytochrome b5 reductase; Provisional | Back alignment and domain information |
|---|
| >PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional | Back alignment and domain information |
|---|
| >cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol | Back alignment and domain information |
|---|
| >cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin | Back alignment and domain information |
|---|
| >cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins | Back alignment and domain information |
|---|
| >cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain | Back alignment and domain information |
|---|
| >PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated | Back alignment and domain information |
|---|
| >cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit | Back alignment and domain information |
|---|
| >PTZ00319 NADH-cytochrome B5 reductase; Provisional | Back alignment and domain information |
|---|
| >cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain | Back alignment and domain information |
|---|
| >cd06214 PA_degradation_oxidoreductase_like NAD(P) binding domain of ferredoxin reductase like phenylacetic acid (PA) degradation oxidoreductase | Back alignment and domain information |
|---|
| >cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I | Back alignment and domain information |
|---|
| >cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons | Back alignment and domain information |
|---|
| >PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >PRK08051 fre FMN reductase; Validated | Back alignment and domain information |
|---|
| >cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system | Back alignment and domain information |
|---|
| >TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit | Back alignment and domain information |
|---|
| >cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant | Back alignment and domain information |
|---|
| >cd06208 CYPOR_like_FNR These ferredoxin reductases are related to the NADPH cytochrome p450 reductases (CYPOR), but lack the FAD-binding region connecting sub-domain | Back alignment and domain information |
|---|
| >cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor | Back alignment and domain information |
|---|
| >PRK05713 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional | Back alignment and domain information |
|---|
| >PLN03116 ferredoxin--NADP+ reductase; Provisional | Back alignment and domain information |
|---|
| >cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain | Back alignment and domain information |
|---|
| >PLN03115 ferredoxin--NADP(+) reductase; Provisional | Back alignment and domain information |
|---|
| >cd06201 SiR_like2 Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >KOG0536|consensus | Back alignment and domain information |
|---|
| >cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases | Back alignment and domain information |
|---|
| >cd06198 FNR_like_3 NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain | Back alignment and domain information |
|---|
| >COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06182 CYPOR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >PRK08221 anaerobic sulfite reductase subunit B; Provisional | Back alignment and domain information |
|---|
| >cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein | Back alignment and domain information |
|---|
| >TIGR02911 sulfite_red_B sulfite reductase, subunit B | Back alignment and domain information |
|---|
| >cd06185 PDR_like Phthalate dioxygenase reductase (PDR) is an FMN-dependent reductase that mediates electron transfer from NADH to FMN to an iron sulfur cluster | Back alignment and domain information |
|---|
| >PRK05802 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06222 ferredoxin-NADP(+) reductase subunit alpha; Reviewed | Back alignment and domain information |
|---|
| >cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd06197 FNR_like_2 FAD/NAD(P) binding domain of ferredoxin reductase-like proteins | Back alignment and domain information |
|---|
| >cd06200 SiR_like1 Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed | Back alignment and domain information |
|---|
| >PTZ00306 NADH-dependent fumarate reductase; Provisional | Back alignment and domain information |
|---|
| >COG4097 Predicted ferric reductase [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins | Back alignment and domain information |
|---|
| >cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family | Back alignment and domain information |
|---|
| >PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional | Back alignment and domain information |
|---|
| >PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional | Back alignment and domain information |
|---|
| >COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide | Back alignment and domain information |
|---|
| >cd06207 CyPoR_like NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd06199 SiR Cytochrome p450- like alpha subunits of E | Back alignment and domain information |
|---|
| >KOG0537|consensus | Back alignment and domain information |
|---|
| >TIGR01931 cysJ sulfite reductase [NADPH] flavoprotein, alpha-component | Back alignment and domain information |
|---|
| >cd06206 bifunctional_CYPOR These bifunctional proteins fuse N-terminal cytochrome p450 with a cytochrome p450 reductase (CYPOR) | Back alignment and domain information |
|---|
| >cd06202 Nitric_oxide_synthase The ferredoxin-reductase (FNR) like C-terminal domain of the nitric oxide synthase (NOS) fuses with a heme-containing N-terminal oxidase domain | Back alignment and domain information |
|---|
| >cd06203 methionine_synthase_red Human methionine synthase reductase (MSR) restores methionine sythase which is responsible for the regeneration of methionine from homocysteine, as well as the coversion of methyltetrahydrofolate to tetrahydrofolate | Back alignment and domain information |
|---|
| >PLN02292 ferric-chelate reductase | Back alignment and domain information |
|---|
| >cd06204 CYPOR NADPH cytochrome p450 reductase (CYPOR) serves as an electron donor in several oxygenase systems and is a component of nitric oxide synthases and methionine synthase reductases | Back alignment and domain information |
|---|
| >PRK10953 cysJ sulfite reductase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK06214 sulfite reductase; Provisional | Back alignment and domain information |
|---|
| >PLN02631 ferric-chelate reductase | Back alignment and domain information |
|---|
| >PLN02844 oxidoreductase/ferric-chelate reductase | Back alignment and domain information |
|---|
| >PF00970 FAD_binding_6: Oxidoreductase FAD-binding domain; InterPro: IPR008333 These sequences contain an oxidoreductase FAD-binding domain | Back alignment and domain information |
|---|
| >KOG3378|consensus | Back alignment and domain information |
|---|
| >PF00173 Cyt-b5: Cytochrome b5-like Heme/Steroid binding domain This prints entry is a subset of the Pfam entry; InterPro: IPR001199 Cytochromes b5 are ubiquitous electron transport proteins found in animals, plants and yeasts [] | Back alignment and domain information |
|---|
| >COG5274 CYB5 Cytochrome b involved in lipid metabolism [Energy production and conversion / Lipid metabolism] | Back alignment and domain information |
|---|
| >COG0369 CysJ Sulfite reductase, alpha subunit (flavoprotein) [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF00175 NAD_binding_1: Oxidoreductase NAD-binding domain ; InterPro: IPR001433 Bacterial ferredoxin-NADP+ reductase may be bound to the thylakoid membrane or anchored to the thylakoid-bound phycobilisomes | Back alignment and domain information |
|---|
| >KOG1158|consensus | Back alignment and domain information |
|---|
| >KOG0039|consensus | Back alignment and domain information |
|---|
| >PLN03199 delta6-acyl-lipid desaturase-like protein; Provisional | Back alignment and domain information |
|---|
| >PLN03198 delta6-acyl-lipid desaturase; Provisional | Back alignment and domain information |
|---|
| >PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated | Back alignment and domain information |
|---|
| >KOG1159|consensus | Back alignment and domain information |
|---|
| >PF08030 NAD_binding_6: Ferric reductase NAD binding domain; InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins | Back alignment and domain information |
|---|
| >KOG4232|consensus | Back alignment and domain information |
|---|
| >COG2375 ViuB Siderophore-interacting protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >KOG4576|consensus | Back alignment and domain information |
|---|
| >PF08022 FAD_binding_8: FAD-binding domain; InterPro: IPR013112 This FAD binding domain is associated with ferric reductase NAD binding proteins and the heavy chain of Cytochrome b-245 | Back alignment and domain information |
|---|
| >PF08021 FAD_binding_9: Siderophore-interacting FAD-binding domain; InterPro: IPR013113 Proteins in this entry are siderophore-interacting FAD-binding proteins | Back alignment and domain information |
|---|
| >cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins | Back alignment and domain information |
|---|
| >COG4892 Predicted heme/steroid binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins | Back alignment and domain information |
|---|
| >KOG1110|consensus | Back alignment and domain information |
|---|
| >cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) | Back alignment and domain information |
|---|
| >PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional | Back alignment and domain information |
|---|
| >cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins | Back alignment and domain information |
|---|
| >KOG1309|consensus | Back alignment and domain information |
|---|
| >KOG1108|consensus | Back alignment and domain information |
|---|
| >cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins | Back alignment and domain information |
|---|
| >cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) | Back alignment and domain information |
|---|
| >PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown | Back alignment and domain information |
|---|
| >cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 | Back alignment and domain information |
|---|
| >KOG1667|consensus | Back alignment and domain information |
|---|
| >cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 | Back alignment and domain information |
|---|
| >cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins | Back alignment and domain information |
|---|
| >cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 527 | ||||
| 3lf5_A | 88 | Structure Of Human Nadh Cytochrome B5 Oxidoreductas | 2e-27 | ||
| 2eix_A | 243 | The Structure Of Physarum Polycephalum Cytochrome B | 4e-14 | ||
| 2oz0_A | 511 | Mechanistic And Structural Studies Of H373q Flavocy | 6e-11 | ||
| 1ldc_A | 511 | X-Ray Structure Of Two Complexes Of The Y143f Flavo | 6e-11 | ||
| 1fcb_A | 511 | Molecular Structure Of Flavocytochrome B2 At 2.4 An | 6e-11 | ||
| 1sze_A | 511 | L230a Mutant Flavocytochrome B2 With Benzoylformate | 7e-11 | ||
| 1szf_A | 511 | A198g:l230a Mutant Flavocytochrome B2 With Pyruvate | 7e-11 | ||
| 1ltd_A | 506 | The 2.6 Angstroms Refined Structure Of The Escheric | 7e-11 | ||
| 3ks0_A | 95 | Crystal Structure Of The Heme Domain Of Flavocytoch | 2e-10 | ||
| 1cnf_A | 270 | Structural Studies On Corn Nitrate Reductase: Refin | 4e-10 | ||
| 1cne_A | 270 | Structural Studies On Corn Nitrate Reductase: Refin | 4e-10 | ||
| 1b5m_A | 84 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 6e-09 | ||
| 3mus_A | 87 | 2a Resolution Structure Of Rat Type B Cytochrome B5 | 6e-09 | ||
| 3ner_A | 92 | Structure Of Human Type B Cytochrome B5 Length = 92 | 1e-08 | ||
| 1eue_A | 86 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 1e-08 | ||
| 3ozz_B | 82 | Structure Of A Cytochrome B5 Core-Swap Mutant Lengt | 1e-08 | ||
| 1awp_A | 92 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 2e-08 | ||
| 2i89_A | 93 | Structure Of Septuple Mutant Of Rat Outer Mitochond | 2e-08 | ||
| 1umk_A | 275 | The Structure Of Human Erythrocyte Nadh-Cytochrome | 2e-08 | ||
| 1icc_A | 87 | Rat Outer Mitochondrial Membrane Cytochrome B5 Leng | 2e-08 | ||
| 1ndh_A | 272 | Crystal Structure Of Nadh-Cytochrome B5 Reductase F | 6e-08 | ||
| 2ibj_A | 88 | Structure Of House Fly Cytochrome B5 Length = 88 | 7e-08 | ||
| 1lj0_A | 92 | Structure Of Quintuple Mutant Of The Rat Outer Mito | 1e-07 | ||
| 1ib0_A | 274 | Crystal Structure Of Rat B5r In Complex With Fad An | 2e-07 | ||
| 1lqx_A | 82 | Crystal Structure Of V45e Mutant Of Cytochrome B5 L | 3e-07 | ||
| 1qx4_A | 274 | Structrue Of S127p Mutant Of Cytochrome B5 Reductas | 6e-07 | ||
| 2i96_A | 108 | Solution Structure Of The Oxidized Microsomal Human | 7e-07 | ||
| 1m20_A | 82 | Crystal Structure Of F35y Mutant Of Trypsin-Solubil | 9e-07 | ||
| 1sh4_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 1e-06 | ||
| 1lr6_A | 82 | Crystal Structure Of V45y Mutant Of Cytochrome B5 L | 2e-06 | ||
| 2m33_A | 104 | Solution Nmr Structure Of Full-length Oxidized Micr | 3e-06 | ||
| 1ehb_A | 82 | Crystal Structure Of Recombinant Trypsin-Solubilize | 3e-06 | ||
| 1do9_A | 94 | Solution Structure Of Oxidized Microsomal Rabbit Cy | 3e-06 | ||
| 1x3x_A | 82 | Crystal Structure Of Cytochrome B5 From Ascaris Suu | 3e-06 | ||
| 1cyo_A | 93 | Bovine Cytochrome B(5) Length = 93 | 4e-06 | ||
| 1hko_A | 104 | Nmr Structure Of Bovine Cytochrome B5 Length = 104 | 4e-06 | ||
| 1ib7_A | 94 | Solution Structure Of F35y Mutant Of Rat Ferro Cyto | 6e-06 | ||
| 1u9u_A | 82 | Crystal Structure Of F58y Mutant Of Cytochrome B5 L | 7e-06 | ||
| 1u9m_A | 82 | Crystal Structure Of F58w Mutant Of Cytochrome B5 L | 1e-05 | ||
| 1jex_A | 94 | Solution Structure Of A67v Mutant Of Rat Ferro Cyto | 2e-05 | ||
| 1i87_A | 98 | Solution Structure Of The Water-Soluble Fragment Of | 2e-05 | ||
| 1aqa_A | 94 | Solution Structure Of Reduced Microsomal Rat Cytoch | 2e-05 | ||
| 1blv_A | 94 | Solution Structure Of Oxidized Rat Microsomal Cytoc | 2e-05 | ||
| 1bfx_A | 99 | The Solution Nmr Structure Of The B Form Of Oxidize | 2e-05 | ||
| 1i5u_A | 82 | Solution Structure Of Cytochrome B5 Triple Mutant ( | 2e-05 | ||
| 1es1_A | 82 | Crystal Structure Of Val61his Mutant Of Trypsin-Sol | 2e-05 | ||
| 1j0q_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 2e-05 | ||
| 1m59_A | 82 | Crystal Structure Of P40v Mutant Of Trypsin-Solubil | 4e-05 | ||
| 1cxy_A | 90 | Structure And Characterization Of Ectothiorhodospir | 5e-05 | ||
| 1m2i_A | 82 | Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME | 7e-05 | ||
| 1f03_A | 82 | Solution Structure Of Oxidized Bovine Microsomal Cy | 1e-04 | ||
| 1m2m_A | 82 | Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cyt | 1e-04 |
| >pdb|3LF5|A Chain A, Structure Of Human Nadh Cytochrome B5 Oxidoreductase (Ncb5or) B5 Domain To 1.25a Resolution Length = 88 | Back alignment and structure |
|
| >pdb|2EIX|A Chain A, The Structure Of Physarum Polycephalum Cytochrome B5 Reductase Length = 243 | Back alignment and structure |
| >pdb|2OZ0|A Chain A, Mechanistic And Structural Studies Of H373q Flavocytochrome B2: Effects Of Mutating The Active Site Base Length = 511 | Back alignment and structure |
| >pdb|1LDC|A Chain A, X-Ray Structure Of Two Complexes Of The Y143f Flavocytochrome B2 Mutant Crystallized In The Presence Of Lactate Or Phenyl-Lactate Length = 511 | Back alignment and structure |
| >pdb|1FCB|A Chain A, Molecular Structure Of Flavocytochrome B2 At 2.4 Angstroms Resolution Length = 511 | Back alignment and structure |
| >pdb|1SZE|A Chain A, L230a Mutant Flavocytochrome B2 With Benzoylformate Length = 511 | Back alignment and structure |
| >pdb|1SZF|A Chain A, A198g:l230a Mutant Flavocytochrome B2 With Pyruvate Bound Length = 511 | Back alignment and structure |
| >pdb|1LTD|A Chain A, The 2.6 Angstroms Refined Structure Of The Escherichia Coli Recombinant Saccharomyces Cerevisiae Flavocytochrome B2-Sulphite Complex Length = 506 | Back alignment and structure |
| >pdb|3KS0|A Chain A, Crystal Structure Of The Heme Domain Of Flavocytochrome B2 In Complex With Fab B2b4 Length = 95 | Back alignment and structure |
| >pdb|1CNF|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 | Back alignment and structure |
| >pdb|1CNE|A Chain A, Structural Studies On Corn Nitrate Reductase: Refined Structure Of The Cytochrome B Reductase Fragment At 2.5 Angstroms, Its Adp Complex And An Active Site Mutant And Modeling Of The Cytochrome B Domain Length = 270 | Back alignment and structure |
| >pdb|1B5M|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 84 | Back alignment and structure |
| >pdb|3MUS|A Chain A, 2a Resolution Structure Of Rat Type B Cytochrome B5 Length = 87 | Back alignment and structure |
| >pdb|3NER|A Chain A, Structure Of Human Type B Cytochrome B5 Length = 92 | Back alignment and structure |
| >pdb|1EUE|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 86 | Back alignment and structure |
| >pdb|3OZZ|B Chain B, Structure Of A Cytochrome B5 Core-Swap Mutant Length = 82 | Back alignment and structure |
| >pdb|1AWP|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 92 | Back alignment and structure |
| >pdb|2I89|A Chain A, Structure Of Septuple Mutant Of Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 93 | Back alignment and structure |
| >pdb|1UMK|A Chain A, The Structure Of Human Erythrocyte Nadh-Cytochrome B5 Reductase Length = 275 | Back alignment and structure |
| >pdb|1ICC|A Chain A, Rat Outer Mitochondrial Membrane Cytochrome B5 Length = 87 | Back alignment and structure |
| >pdb|1NDH|A Chain A, Crystal Structure Of Nadh-Cytochrome B5 Reductase From Pig Liver At 2.4 Angstroms Resolution Length = 272 | Back alignment and structure |
| >pdb|2IBJ|A Chain A, Structure Of House Fly Cytochrome B5 Length = 88 | Back alignment and structure |
| >pdb|1LJ0|A Chain A, Structure Of Quintuple Mutant Of The Rat Outer Mitocondrial Cytochrome B5. Length = 92 | Back alignment and structure |
| >pdb|1IB0|A Chain A, Crystal Structure Of Rat B5r In Complex With Fad And Nad Length = 274 | Back alignment and structure |
| >pdb|1LQX|A Chain A, Crystal Structure Of V45e Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1QX4|A Chain A, Structrue Of S127p Mutant Of Cytochrome B5 Reductase Length = 274 | Back alignment and structure |
| >pdb|2I96|A Chain A, Solution Structure Of The Oxidized Microsomal Human Cytochrome B5 Length = 108 | Back alignment and structure |
| >pdb|1M20|A Chain A, Crystal Structure Of F35y Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1SH4|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V45h Length = 82 | Back alignment and structure |
| >pdb|1LR6|A Chain A, Crystal Structure Of V45y Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|2M33|A Chain A, Solution Nmr Structure Of Full-length Oxidized Microsomal Rabbit Cytochrome B5 Length = 104 | Back alignment and structure |
| >pdb|1EHB|A Chain A, Crystal Structure Of Recombinant Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1DO9|A Chain A, Solution Structure Of Oxidized Microsomal Rabbit Cytochrome B5. Factors Determining The Heterogeneous Binding Of The Heme Length = 94 | Back alignment and structure |
| >pdb|1X3X|A Chain A, Crystal Structure Of Cytochrome B5 From Ascaris Suum Length = 82 | Back alignment and structure |
| >pdb|1CYO|A Chain A, Bovine Cytochrome B(5) Length = 93 | Back alignment and structure |
| >pdb|1HKO|A Chain A, Nmr Structure Of Bovine Cytochrome B5 Length = 104 | Back alignment and structure |
| >pdb|1U9U|A Chain A, Crystal Structure Of F58y Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1U9M|A Chain A, Crystal Structure Of F58w Mutant Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1JEX|A Chain A, Solution Structure Of A67v Mutant Of Rat Ferro Cytochrome B5 Length = 94 | Back alignment and structure |
| >pdb|1I87|A Chain A, Solution Structure Of The Water-Soluble Fragment Of Rat Hepatic Apocytochrome B5 Length = 98 | Back alignment and structure |
| >pdb|1AQA|A Chain A, Solution Structure Of Reduced Microsomal Rat Cytochrome B5, Nmr, Minimized Average Structure Length = 94 | Back alignment and structure |
| >pdb|1BLV|A Chain A, Solution Structure Of Oxidized Rat Microsomal Cytochrome B5 In The Presence Of 2 M Guanidinium Chloride: Monitoring The Early Steps In Protein Unfolding Length = 94 | Back alignment and structure |
| >pdb|1BFX|A Chain A, The Solution Nmr Structure Of The B Form Of Oxidized Rat Microsomal Cytochrome B5, Minimized Average Structure Length = 99 | Back alignment and structure |
| >pdb|1I5U|A Chain A, Solution Structure Of Cytochrome B5 Triple Mutant (E48aE56AD60A) Length = 82 | Back alignment and structure |
| >pdb|1ES1|A Chain A, Crystal Structure Of Val61his Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1J0Q|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant V61h Length = 82 | Back alignment and structure |
| >pdb|1M59|A Chain A, Crystal Structure Of P40v Mutant Of Trypsin-Solubilized Fragment Of Cytochrome B5 Length = 82 | Back alignment and structure |
| >pdb|1CXY|A Chain A, Structure And Characterization Of Ectothiorhodospira Vacuolata Cytochrome B558, A Prokaryotic Homologue Of Cytochrome B5 Length = 90 | Back alignment and structure |
| >pdb|1M2I|A Chain A, Crystal Structure Of E44aE56A MUTANT OF CYTOCHROME B5 Length = 82 | Back alignment and structure |
| >pdb|1F03|A Chain A, Solution Structure Of Oxidized Bovine Microsomal Cytochrome B5 Mutant (E44a, E48a, E56a, D60a) And Its Interaction With Cytochrome C Length = 82 | Back alignment and structure |
| >pdb|1M2M|A Chain A, Crystal Structure Of E44aE48AE56AD60A MUTANT OF Cytochrome B5 Length = 82 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} Length = 243 | Back alignment and structure |
|---|
Score = 147 bits (374), Expect = 2e-41
Identities = 51/172 (29%), Positives = 83/172 (48%), Gaps = 9/172 (5%)
Query: 275 KFNTMRLLHQEQVTHNVVLITLEYTSP-MFFYVPVGHHVFIKFIVNDVDISKPYTPVEPL 333
++ L ++ + HN L P +P+G H+ +K V+ +I +PYTPV
Sbjct: 10 EYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATVDGKEIYRPYTPV--- 66
Query: 334 QAAPLSYSNTLTFLIKSYEDGLLSPLLCGLREGQELEVSSPEGKFDVGLIGKRNKLVLLA 393
+ +IK YE G +S + L G L+V P+G+FD ++ ++A
Sbjct: 67 --SSDDEKGYFDLIIKVYEKGQMSQYIDHLNPGDFLQVRGPKGQFDY-KPNMVKEMGMIA 123
Query: 394 AGTGLTPMIPVINWSIQ--SQRQSVQLVFFNRTEQDIIWRDQLDTFASKNSK 443
GTG+TPM+ V I+ ++ + L+F N E DI+ R +LD A K S
Sbjct: 124 GGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDILLRTELDDMAKKYSN 175
|
| >1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* Length = 275 | Back alignment and structure |
|---|
| >3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} Length = 88 | Back alignment and structure |
|---|
| >2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* Length = 270 | Back alignment and structure |
|---|
| >1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... Length = 93 | Back alignment and structure |
|---|
| >1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* Length = 104 | Back alignment and structure |
|---|
| >3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* Length = 92 | Back alignment and structure |
|---|
| >2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} Length = 88 | Back alignment and structure |
|---|
| >2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} Length = 112 | Back alignment and structure |
|---|
| >1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* Length = 248 | Back alignment and structure |
|---|
| >1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} Length = 82 | Back alignment and structure |
|---|
| >1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 Length = 90 | Back alignment and structure |
|---|
| >4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* Length = 271 | Back alignment and structure |
|---|
| >1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 Length = 82 | Back alignment and structure |
|---|
| >1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 Length = 250 | Back alignment and structure |
|---|
| >2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* Length = 257 | Back alignment and structure |
|---|
| >2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* Length = 272 | Back alignment and structure |
|---|
| >1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* Length = 403 | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 338 | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* Length = 511 | Back alignment and structure |
|---|
| >4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} Length = 243 | Back alignment and structure |
|---|
| >1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 Length = 232 | Back alignment and structure |
|---|
| >1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 Length = 396 | Back alignment and structure |
|---|
| >1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* Length = 262 | Back alignment and structure |
|---|
| >2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} Length = 290 | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Length = 321 | Back alignment and structure |
|---|
| >1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* Length = 466 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A Length = 102 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 527 | |||
| 2eix_A | 243 | NADH-cytochrome B5 reductase; flavoprotein, FAD-bi | 100.0 | |
| 1tvc_A | 250 | Methane monooxygenase component C, methane monooxy | 100.0 | |
| 2r6h_A | 290 | NADH:ubiquinone oxidoreductase, Na translocating, | 100.0 | |
| 4eh1_A | 243 | Flavohemoprotein; structural genomics, niaid, nati | 100.0 | |
| 1fdr_A | 248 | Flavodoxin reductase; ferredoxin reductase, flavin | 100.0 | |
| 1umk_A | 275 | B5R, NADH-cytochrome B5 reductase; flavoprotein, b | 100.0 | |
| 4fk8_A | 271 | Ferredoxin--NADP reductase; ssgcid, NIH, niaid, st | 100.0 | |
| 2qdx_A | 257 | Ferredoxin reductase; oxidoreductase; HET: FAD; 1. | 100.0 | |
| 4g1v_A | 399 | Flavohemoglobin; three domains: globin fold, antip | 100.0 | |
| 1gvh_A | 396 | Flavohemoprotein; oxidoreductase, NADP, heme, flav | 100.0 | |
| 2cnd_A | 270 | NADH-dependent nitrate reductase; nitrate assimila | 100.0 | |
| 1qfj_A | 232 | Protein (flavin reductase); riboflavin, ferredoxin | 100.0 | |
| 1cqx_A | 403 | Flavohemoprotein; globin fold, six-stranded antipa | 100.0 | |
| 3vo2_A | 310 | Putative uncharacterized protein; rossmann fold, o | 100.0 | |
| 2bgi_A | 272 | Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxi | 100.0 | |
| 1krh_A | 338 | Benzoate 1,2-dioxygenase reductase; alpha-beta, FA | 100.0 | |
| 3lo8_A | 311 | Ferredoxin--NADP reductase; electron transport, ox | 100.0 | |
| 2pia_A | 321 | Phthalate dioxygenase reductase; HET: FMN; 2.00A { | 100.0 | |
| 1fnb_A | 314 | Ferredoxin-NADP+ reductase; oxidoreductase (NADP+( | 99.98 | |
| 1ep3_B | 262 | Dihydroorotate dehydrogenase B (PYRK subunit); het | 99.98 | |
| 3jqq_A | 316 | Ferredoxin NADP reductase; FAD, oxidoreductase; HE | 99.98 | |
| 2b5o_A | 402 | FNR, ferredoxin--NADP reductase; complex with FAD, | 99.97 | |
| 2bmw_A | 304 | Ferredoxin--NADP reductase; oxidoreductase, flavop | 99.97 | |
| 2rc5_A | 314 | Ferredoxin-NADP reductase; FAD, oxidoreductase; HE | 99.97 | |
| 2gpj_A | 252 | Siderophore-interacting protein; structural genomi | 99.95 | |
| 1ddg_A | 374 | Sulfite reductase (NADPH) flavoprotein alpha- comp | 99.93 | |
| 3lf5_A | 88 | Cytochrome B5 reductase 4; NCB5OR, electron transf | 99.9 | |
| 1f20_A | 435 | Nitric-oxide synthase; nitric-xoide synthase, redu | 99.89 | |
| 3ner_A | 92 | Cytochrome B5 type B; heme, electron transport; HE | 99.89 | |
| 4dql_A | 393 | Bifunctional P-450/NADPH-P450 reductase; rossmann | 99.88 | |
| 1cyo_A | 93 | Cytochrome B5; electron transport; HET: HEM; 1.50A | 99.88 | |
| 1hko_A | 104 | Cytochrome B5; electron transfer protein, heme, el | 99.88 | |
| 2ibj_A | 88 | Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY dif | 99.88 | |
| 2qtl_A | 539 | MSR;, methionine synthase reductase; alpha-beta-al | 99.87 | |
| 1tll_A | 688 | Nitric-oxide synthase, brain; reductase module, FM | 99.87 | |
| 1x3x_A | 82 | Cytochrome B5; hemoprotein, porcine parasitic nama | 99.87 | |
| 3qfs_A | 458 | CPR, P450R, NADPH--cytochrome P450 reductase; flav | 99.87 | |
| 1cxy_A | 90 | Cytochrome B5; helix, beta-strand, electron transp | 99.86 | |
| 1mj4_A | 82 | Sulfite oxidase; cytochrome B5, heme, oxidoreducta | 99.85 | |
| 3qe2_A | 618 | CPR, P450R, NADPH--cytochrome P450 reductase; cypo | 99.85 | |
| 2bpo_A | 682 | CPR, P450R, NADPH-cytochrom P450 reductase; NADPH- | 99.84 | |
| 2keo_A | 112 | Probable E3 ubiquitin-protein ligase HERC2; protei | 99.84 | |
| 3lrx_A | 158 | Putative hydrogenase; alpha-beta protein, structur | 99.81 | |
| 3lyu_A | 142 | Putative hydrogenase; the C-terminal has AN alpha- | 99.76 | |
| 3a1f_A | 186 | Cytochrome B-245 heavy chain; GP91(PHOX), NADPH bi | 99.75 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 99.68 | |
| 1sox_A | 466 | Sulfite oxidase; oxidoreductase, sulfite oxidation | 99.67 | |
| 1j03_A | 102 | Putative steroid binding protein; alpha and beta, | 99.5 | |
| 1wh0_A | 134 | Ubiquitin carboxyl-terminal hydrolase 19; USP, CS | 96.88 | |
| 2xcm_C | 92 | SGT1-like protein, cytosolic heat shock protein 90 | 96.76 | |
| 1rl1_A | 114 | Suppressor of G2 allele of SKP1 homolog; beta sand | 96.3 | |
| 1x5m_A | 127 | Calcyclin-binding protein; CS domain, structural g | 95.85 | |
| 2kmw_A | 150 | Uncharacterized protein AT3G03773; protein structu | 93.55 | |
| 2o30_A | 131 | Nuclear movement protein; MCSG, structural genomic | 91.12 | |
| 1ejf_A | 125 | Progesterone receptor P23; chaperone, CO-chaperone | 90.32 | |
| 1wgv_A | 124 | KIAA1068 protein; CS domain, HSP20-like fold, stru | 87.58 | |
| 2cg9_X | 134 | CO-chaperone protein SBA1; chaperone complex, HSP9 | 82.87 |
| >2eix_A NADH-cytochrome B5 reductase; flavoprotein, FAD-binding domain, NADH-binding, oxidoreducta; HET: FAD; 1.56A {Physarum polycephalum} | Back alignment and structure |
|---|
Probab=100.00 E-value=5.1e-35 Score=286.83 Aligned_cols=222 Identities=24% Similarity=0.384 Sum_probs=181.4
Q ss_pred CCCceEEEEEEEEEEecCCEEEEEEEeCCCc-CcccCCccEEEEEEEeCCeeeeeeeeccCCCCCCCCCCCCEEEEEEEE
Q psy8246 272 PVSKFNTMRLLHQEQVTHNVVLITLEYTSPM-FFYVPVGHHVFIKFIVNDVDISKPYTPVEPLQAAPLSYSNTLTFLIKS 350 (527)
Q Consensus 272 ~~~~~~~~~v~~~~~vs~d~~~~~~~~p~~~-~~~~~pGQ~v~l~~~~~g~~~~R~YT~~s~~~~~~~~~~~~l~l~IK~ 350 (527)
.+..|+.++|++++.++++++.|+|+.+... ...++|||||.|+++.+|....|+|||++.+. +.+.++|+||+
T Consensus 7 ~~~~~~~~~v~~~~~~t~~~~~~~l~~~~~~~~~~~~pGq~v~l~~~~~g~~~~R~ysi~s~~~-----~~~~~~l~vk~ 81 (243)
T 2eix_A 7 NPNEYKKFMLREKQIINHNTRLFRFNLHHPEDVVGLPIGQHMSVKATVDGKEIYRPYTPVSSDD-----EKGYFDLIIKV 81 (243)
T ss_dssp CSSSCEEEEEEEEEEEETTEEEEEEECSSTTCCCCCCTTCEEEEEEEETTEEEEEEECCCSCTT-----CCSEEEEEEEC
T ss_pred CCCceEEEEEEEEEEeCCCeEEEEEEcCCCCcccCcCCceEEEEEEeeCCCEEEeeeeecCCCC-----CCCEEEEEEEE
Confidence 3456889999999999999999999988643 34599999999999888888899999999763 57899999999
Q ss_pred eCCCCchHhhhcCCCCCEEEEeccccccccCCCCCCccEEEEEecCCchhHHHHHHHHHHhC--CCcEEEEEEeCCCchh
Q psy8246 351 YEDGLLSPLLCGLREGQELEVSSPEGKFDVGLIGKRNKLVLLAAGTGLTPMIPVINWSIQSQ--RQSVQLVFFNRTEQDI 428 (527)
Q Consensus 351 y~~G~~S~~L~~l~~Gd~v~i~GP~G~f~~~~~~~~~~ivlIAgGtGItP~l~ll~~l~~~~--~~~v~L~~~~r~~~di 428 (527)
+++|.+|+||+++++||+|.|.||+|.|.+.. +..++++|||||||||||++|++++.... ..+++|+|++|+.+|+
T Consensus 82 ~~~G~~S~~l~~l~~Gd~v~v~gP~G~f~~~~-~~~~~~vliagG~GiaP~~~~l~~l~~~~~~~~~v~l~~~~r~~~~~ 160 (243)
T 2eix_A 82 YEKGQMSQYIDHLNPGDFLQVRGPKGQFDYKP-NMVKEMGMIAGGTGITPMLQVARAIIKNPKEKTIINLIFANVNEDDI 160 (243)
T ss_dssp CTTCHHHHHHHTCCTTCEEEEEEEECSCCCCT-TSSSEEEEEEEGGGHHHHHHHHHHHHTCTTCCCEEEEEEEEEEGGGC
T ss_pred cCCCCcchHhhcCCCCCEEEEECCeEEEEeCC-CCCcEEEEEecCccHHHHHHHHHHHHhCCCCCcEEEEEEEcCCHHHh
Confidence 98999999999999999999999999998765 35689999999999999999999998752 5799999999999999
Q ss_pred hhHHHHHHHHhcCCCCeEeccCCCCCCcccccccccchhhhhhchhHHHhhhcC--CCcEEEEcCchHHHHHHHHHHHHh
Q psy8246 429 IWRDQLDTFASKNSKPSSPRNPSTEIKPLKNIISFLMRIRTTLKRVELEDLLNS--NSLVYSQLNLPYAVAAVADKMTGM 506 (527)
Q Consensus 429 ~~~~eL~~l~~~~~~~~~~~~~s~~~~~~~g~~~~~~ri~~~~~~~~l~~l~~~--~~~~~yiCGPp~m~~~v~~~L~~l 506 (527)
++++||+++++++++++++...+++..+..+ ..+++.. ..+.+.+.. ....+|+|||++|++++++.|+++
T Consensus 161 ~~~~el~~l~~~~~~~~~~~~~s~~~~~~~g---~~g~v~~----~~l~~~~~~~~~~~~vy~CGp~~m~~~v~~~l~~~ 233 (243)
T 2eix_A 161 LLRTELDDMAKKYSNFKVYYVLNNPPAGWTG---GVGFVSA----DMIKQHFSPPSSDIKVMMCGPPMMNKAMQGHLETL 233 (243)
T ss_dssp TTHHHHHHHHHHCTTEEEEEEEEECCTTCCS---EESSCCH----HHHHHHSCCTTSSEEEEEESSHHHHHHHHHHHHHH
T ss_pred hHHHHHHHHHHHCCCeEEEEEeCCCCccccC---cCCccCH----HHHHHhcCCCCCCeEEEEECCHHHHHHHHHHHHHc
Confidence 9999999998877788887655432211111 1233322 123333322 345688999999999999999875
|
| >1tvc_A Methane monooxygenase component C, methane monooxygenase; FAD-binding, NADH-binding, oxidoreductase; HET: FDA; NMR {Methylococcus capsulatus} SCOP: b.43.4.2 c.25.1.2 | Back alignment and structure |
|---|
| >2r6h_A NADH:ubiquinone oxidoreductase, Na translocating, subunit; alpha-beta-alpha sandwich, structural genomics, PSI-2; HET: FAD; 2.95A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >4eh1_A Flavohemoprotein; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: FAD; 2.20A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1fdr_A Flavodoxin reductase; ferredoxin reductase, flavin, oxidoreductase, flavoprotein; HET: FAD; 1.70A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 PDB: 2xnj_A* 3fpk_A* | Back alignment and structure |
|---|
| >1umk_A B5R, NADH-cytochrome B5 reductase; flavoprotein, beta barrel, FAD-binding domain, NADH-binding domain, oxidoreductase; HET: FAD; 1.75A {Homo sapiens} SCOP: b.43.4.2 c.25.1.1 PDB: 1ndh_A* 1i7p_A* 1ib0_A* 1qx4_A* | Back alignment and structure |
|---|
| >4fk8_A Ferredoxin--NADP reductase; ssgcid, NIH, niaid, structural genomics, national institute allergy and infectious diseases; HET: FAD; 2.10A {Burkholderia thailandensis} PDB: 4f7d_A* | Back alignment and structure |
|---|
| >2qdx_A Ferredoxin reductase; oxidoreductase; HET: FAD; 1.55A {Pseudomonas aeruginosa} PDB: 3crz_A* 1a8p_A* | Back alignment and structure |
|---|
| >4g1v_A Flavohemoglobin; three domains: globin fold, antiparallel beta-barrel, alpha/ fold, RESP., FAD, oxidoreductase; HET: HEM FAD; 2.10A {Saccharomyces cerevisiae} PDB: 4g1b_A* | Back alignment and structure |
|---|
| >1gvh_A Flavohemoprotein; oxidoreductase, NADP, heme, flavoprotein, FAD, iron transpor; HET: FAD HEM; 2.19A {Escherichia coli} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 | Back alignment and structure |
|---|
| >2cnd_A NADH-dependent nitrate reductase; nitrate assimilating enzyme, oxidoreductase, nitrogenous acceptor; HET: FAD; 2.50A {Zea mays} SCOP: b.43.4.2 c.25.1.1 PDB: 1cnf_A* 1cne_A* | Back alignment and structure |
|---|
| >1qfj_A Protein (flavin reductase); riboflavin, ferredoxin reductase superfami oxidoreductase; 2.20A {Escherichia coli} SCOP: b.43.4.2 c.25.1.1 | Back alignment and structure |
|---|
| >1cqx_A Flavohemoprotein; globin fold, six-stranded antiparallel beta sheet, helix-FLA five-stranded parallel beta sheet, lipid binding protein; HET: HEM FAD DGG; 1.75A {Cupriavidus necator} SCOP: a.1.1.2 b.43.4.2 c.25.1.5 PDB: 3ozu_A* 3ozv_B* 3ozw_A* | Back alignment and structure |
|---|
| >3vo2_A Putative uncharacterized protein; rossmann fold, oxidoreductase, FAD binding; HET: FAD; 1.39A {Zea mays} PDB: 3vo1_A* 1gaw_A* 1gaq_A* 1qg0_A* 4af6_A* 1qga_A* 1qfz_A* 1qfy_A* 4af7_A* 1sm4_A* 3mhp_A* 1fnb_A* 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 2xnc_A* | Back alignment and structure |
|---|
| >2bgi_A Ferredoxin-NADP(H) reductase; ferredoxin(flavodoxin)-NADP(H) reductase, flavoproteins, electron transfer, oxidoreductase; HET: FAD HTG; 1.68A {Rhodobacter capsulatus} PDB: 2bgj_A* 2vnh_A* 2vni_A* 2vnj_A* 2vnk_A* | Back alignment and structure |
|---|
| >1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >3lo8_A Ferredoxin--NADP reductase; electron transport, oxidoreductase, FAD, flavoprotein; HET: FAD; 1.05A {Zea mays} PDB: 3lvb_A* 1jb9_A* | Back alignment and structure |
|---|
| >2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 | Back alignment and structure |
|---|
| >1fnb_A Ferredoxin-NADP+ reductase; oxidoreductase (NADP+(A),ferredoxin(A)); HET: FAD; 1.70A {Spinacia oleracea} SCOP: b.43.4.2 c.25.1.1 PDB: 1fnc_A* 1fnd_A* 1bx1_A* 1frq_A* 1frn_A* 1bx0_A* 1qg0_A* 1qga_A* 1qfz_A* 1qfy_A* 1gaw_A* 1gaq_A* 3mhp_A* 1sm4_A* 2xnc_A* | Back alignment and structure |
|---|
| >1ep3_B Dihydroorotate dehydrogenase B (PYRK subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: b.43.4.2 c.25.1.3 PDB: 1ep1_B* 1ep2_B* | Back alignment and structure |
|---|
| >3jqq_A Ferredoxin NADP reductase; FAD, oxidoreductase; HET: FAD A2P; 2.20A {Plasmodium falciparum} PDB: 2ok8_A* 2ok7_A* 3jqr_A* 3jqp_A* | Back alignment and structure |
|---|
| >2b5o_A FNR, ferredoxin--NADP reductase; complex with FAD, oxidoreductase; HET: FAD; 2.50A {Synechococcus SP} | Back alignment and structure |
|---|
| >2bmw_A Ferredoxin--NADP reductase; oxidoreductase, flavoprotein, FAD, FNR, reductase reductase, phycobilisome, thylakoid; HET: FAD; 1.5A {Anabaena SP} SCOP: b.43.4.2 c.25.1.1 PDB: 1h42_A* 2vyq_A* 2vzl_A* 1ogi_A* 1ogj_A* 1gjr_A* 1e62_A* 1e64_A* 1quf_A* 1e63_A* 1go2_A* 1w34_A* 1b2r_A* 1w35_A* 1w87_A* 1que_A* 1ewy_A* 1gr1_A* 2bsa_A* 1bqe_A* ... | Back alignment and structure |
|---|
| >2rc5_A Ferredoxin-NADP reductase; FAD, oxidoreductase; HET: FAD; 2.43A {Leptospira interrogans} PDB: 2rc6_A* | Back alignment and structure |
|---|
| >2gpj_A Siderophore-interacting protein; structural genomics, joint for structural genomics, JCSG; HET: FAD; 2.20A {Shewanella putrefaciens} | Back alignment and structure |
|---|
| >1ddg_A Sulfite reductase (NADPH) flavoprotein alpha- component; cytochrome P450 reductase, FNR, modular protein, oxidoreductase; HET: FAD; 2.01A {Escherichia coli} SCOP: b.43.4.1 c.25.1.4 PDB: 1ddi_A* | Back alignment and structure |
|---|
| >3lf5_A Cytochrome B5 reductase 4; NCB5OR, electron transfer, redox, heme, endoplasmic reticulu flavoprotein, iron, metal-binding, NAD, oxidoreductase; HET: HEM; 1.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1f20_A Nitric-oxide synthase; nitric-xoide synthase, reductase domain, FAD, NADP+, oxidore; HET: FAD NAP; 1.90A {Rattus norvegicus} SCOP: b.43.4.1 c.25.1.4 | Back alignment and structure |
|---|
| >3ner_A Cytochrome B5 type B; heme, electron transport; HET: HEM; 1.45A {Homo sapiens} SCOP: d.120.1.1 PDB: 1awp_A* 3mus_A* 1b5m_A* 1eue_A* 1icc_A* 1lj0_A* 2i89_A* | Back alignment and structure |
|---|
| >4dql_A Bifunctional P-450/NADPH-P450 reductase; rossmann fold, redox, FAD and NADP+ binding, oxidoreductase; HET: FAD NAP 1PE PG4; 2.15A {Bacillus megaterium} PDB: 4dqk_A* | Back alignment and structure |
|---|
| >1cyo_A Cytochrome B5; electron transport; HET: HEM; 1.50A {Bos taurus} SCOP: d.120.1.1 PDB: 1bfx_A* 1i87_A 1i8c_A 1iet_A 1ieu_A 1do9_A* 1aqa_A* 1aw3_A* 1axx_A* 1b5a_A* 1b5b_A* 1blv_A* 1mny_A* 2axx_A* 1ib7_A* 1jex_A* 1ehb_A* 1nx7_A* 1u9u_A* 1m20_A* ... | Back alignment and structure |
|---|
| >1hko_A Cytochrome B5; electron transfer protein, heme, electron transport; HET: HEM; NMR {Bos taurus} SCOP: d.120.1.1 PDB: 2i96_A* | Back alignment and structure |
|---|
| >2ibj_A Cytochrome B5, CYTB5; FLY cytochrome B5, X-RAY diffraction, heme, electron transport; HET: HEM; 1.55A {Musca domestica} | Back alignment and structure |
|---|
| >2qtl_A MSR;, methionine synthase reductase; alpha-beta-alpha structural motif, flattened antiparallel BE barrel, flexible hinge region, connecting domain; HET: FAD; 1.90A {Homo sapiens} PDB: 2qtz_A* | Back alignment and structure |
|---|
| >1tll_A Nitric-oxide synthase, brain; reductase module, FMN, FAD, NADP+, oxidoreductase; HET: FMN FAD NAP; 2.30A {Rattus norvegicus} SCOP: b.43.4.1 c.23.5.2 c.25.1.4 | Back alignment and structure |
|---|
| >1x3x_A Cytochrome B5; hemoprotein, porcine parasitic namatode, electron transport; HET: HEM; 1.80A {Ascaris suum} | Back alignment and structure |
|---|
| >3qfs_A CPR, P450R, NADPH--cytochrome P450 reductase; flavoprotein, FAD, oxidoreductase; HET: FAD NAP; 1.40A {Homo sapiens} PDB: 3qft_A* | Back alignment and structure |
|---|
| >1cxy_A Cytochrome B5; helix, beta-strand, electron transport; HET: HEM; 1.65A {Ectothiorhodospira shaposhnikovii} SCOP: d.120.1.1 | Back alignment and structure |
|---|
| >1mj4_A Sulfite oxidase; cytochrome B5, heme, oxidoreductase; HET: HEM; 1.20A {Homo sapiens} SCOP: d.120.1.1 | Back alignment and structure |
|---|
| >3qe2_A CPR, P450R, NADPH--cytochrome P450 reductase; cypor, antley-bixler syndrome, flavoprotein, FMN, FAD, oxidoreductase; HET: FAD FMN NAP; 1.75A {Homo sapiens} PDB: 3qfc_A* 3qfr_A* 1amo_A* 1j9z_A* 1ja0_A* 1ja1_A* 3es9_A* 3ojw_A* 3ojx_A* 3fjo_A* 1b1c_A* | Back alignment and structure |
|---|
| >2bpo_A CPR, P450R, NADPH-cytochrom P450 reductase; NADPH-cytochrome P450 reductase, diflavin reductase, FAD, FMN-binding, electron transfer; HET: FAD FMN NAP; 2.9A {Saccharomyces cerevisiae} PDB: 2bn4_A* 2bf4_A* | Back alignment and structure |
|---|
| >2keo_A Probable E3 ubiquitin-protein ligase HERC2; protein of unknown function, HERC2 cytochrome domain, ligase binding, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3lrx_A Putative hydrogenase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.60A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3lyu_A Putative hydrogenase; the C-terminal has AN alpha-beta fold, structural genomics, PSI-2, protein structure initiative; 2.30A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3a1f_A Cytochrome B-245 heavy chain; GP91(PHOX), NADPH binding domain, oxidoreductase; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >1sox_A Sulfite oxidase; oxidoreductase, sulfite oxidation; HET: MTE HEM EPE; 1.90A {Gallus gallus} SCOP: b.1.18.6 d.120.1.1 d.176.1.1 PDB: 3hc2_A* 3hbq_A* 3hbg_A* 3hbp_A* 3r18_A* 3r19_A* | Back alignment and structure |
|---|
| >1j03_A Putative steroid binding protein; alpha and beta, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.120.1.2 PDB: 1t0g_A | Back alignment and structure |
|---|
| >1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 | Back alignment and structure |
|---|
| >2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* | Back alignment and structure |
|---|
| >1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 | Back alignment and structure |
|---|
| >1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 | Back alignment and structure |
|---|
| >1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 | Back alignment and structure |
|---|
| >2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 527 | ||||
| d1kbia2 | 97 | d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal | 4e-24 | |
| d1cyoa_ | 88 | d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [Ta | 1e-22 | |
| d1euea_ | 86 | d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegic | 4e-22 | |
| d1cxya_ | 81 | d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira | 1e-21 | |
| d1mj4a_ | 80 | d.120.1.1 (A:) Sulfite oxidase, N-terminal domain | 1e-19 | |
| d1soxa2 | 91 | d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal dom | 2e-18 | |
| d2cnda1 | 114 | b.43.4.2 (A:11-124) Nitrate reductase core domain | 3e-12 | |
| d1ep3b2 | 160 | c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase | 1e-09 | |
| d1umka1 | 124 | b.43.4.2 (A:30-153) cytochrome b5 reductase {Human | 6e-09 | |
| d1a8pa1 | 99 | b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxi | 2e-08 | |
| d1cqxa2 | 111 | b.43.4.2 (A:151-261) Flavohemoglobin, central doma | 7e-08 | |
| d1ep3b1 | 101 | b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, | 1e-07 | |
| d1cqxa3 | 142 | c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal d | 1e-06 | |
| d2piaa2 | 120 | c.25.1.2 (A:104-223) Phthalate dioxygenase reducta | 2e-06 | |
| d1gvha2 | 107 | b.43.4.2 (A:147-253) Flavohemoglobin, central doma | 3e-06 | |
| d1umka2 | 147 | c.25.1.1 (A:154-300) cytochrome b5 reductase {Huma | 4e-05 | |
| d2cnda2 | 146 | c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea | 6e-05 | |
| d1tvca1 | 109 | b.43.4.2 (A:2-110) Methane monooxygenase component | 6e-05 | |
| d1krha2 | 133 | c.25.1.2 (A:206-338) Benzoate dioxygenase reductas | 1e-04 | |
| d1gvha3 | 143 | c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal d | 2e-04 | |
| d1a8pa2 | 158 | c.25.1.1 (A:101-258) Ferredoxin reductase (flavodo | 3e-04 | |
| d1jb9a2 | 154 | c.25.1.1 (A:163-316) Ferredoxin reductase (flavodo | 4e-04 | |
| d1t0ga_ | 109 | d.120.1.2 (A:) Putative steroid binding protein AT | 4e-04 | |
| d1fdra2 | 148 | c.25.1.1 (A:101-248) Ferredoxin reductase (flavodo | 5e-04 | |
| d1qfja2 | 135 | c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase | 9e-04 | |
| d2bmwa2 | 162 | c.25.1.1 (A:142-303) Ferredoxin reductase (flavodo | 9e-04 | |
| d1rl1a_ | 92 | b.15.1.3 (A:) Suppressor of G2 allele of skp1 homo | 0.001 | |
| d2piaa1 | 103 | b.43.4.2 (A:1-103) Phthalate dioxygenase reductase | 0.003 | |
| d1krha1 | 100 | b.43.4.2 (A:106-205) Benzoate dioxygenase reductas | 0.004 |
| >d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 97 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cytochrome b5-like heme/steroid binding domain superfamily: Cytochrome b5-like heme/steroid binding domain family: Cytochrome b5 domain: Flavocytochrome b2, N-terminal domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Score = 94.2 bits (234), Expect = 4e-24
Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 1/83 (1%)
Query: 50 VSKAQLAEHNKEDDMWMCIRGVVYNVTRYMDFHPGGREELMRGAGMDATELFNKVHPW-V 108
+S A++A+HNK DD W+ I G VY++TR++ HPGG++ + AG D T +F +H V
Sbjct: 11 ISPAEVAKHNKPDDCWVVINGYVYDLTRFLPNHPGGQDVIKFNAGKDVTAIFEPLHAPNV 70
Query: 109 NYESILQKCIVGKMGSSLPDENP 131
+ I + +G + S+P E
Sbjct: 71 IDKYIAPEKKLGPLQGSMPPELV 93
|
| >d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} Length = 88 | Back information, alignment and structure |
|---|
| >d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} Length = 81 | Back information, alignment and structure |
|---|
| >d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 80 | Back information, alignment and structure |
|---|
| >d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 91 | Back information, alignment and structure |
|---|
| >d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} Length = 114 | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 160 | Back information, alignment and structure |
|---|
| >d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} Length = 99 | Back information, alignment and structure |
|---|
| >d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 111 | Back information, alignment and structure |
|---|
| >d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Length = 101 | Back information, alignment and structure |
|---|
| >d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} Length = 142 | Back information, alignment and structure |
|---|
| >d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 120 | Back information, alignment and structure |
|---|
| >d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} Length = 107 | Back information, alignment and structure |
|---|
| >d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 147 | Back information, alignment and structure |
|---|
| >d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} Length = 146 | Back information, alignment and structure |
|---|
| >d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} Length = 109 | Back information, alignment and structure |
|---|
| >d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Length = 133 | Back information, alignment and structure |
|---|
| >d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 143 | Back information, alignment and structure |
|---|
| >d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} Length = 158 | Back information, alignment and structure |
|---|
| >d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} Length = 154 | Back information, alignment and structure |
|---|
| >d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 109 | Back information, alignment and structure |
|---|
| >d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} Length = 148 | Back information, alignment and structure |
|---|
| >d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} Length = 135 | Back information, alignment and structure |
|---|
| >d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} Length = 162 | Back information, alignment and structure |
|---|
| >d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} Length = 103 | Back information, alignment and structure |
|---|
| >d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} Length = 100 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 527 | |||
| d1euea_ | 86 | Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 101 | 99.92 | |
| d1cyoa_ | 88 | Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | 99.91 | |
| d1cxya_ | 81 | Cytochrome b558 {Ectothiorhodospira vacuolata [Tax | 99.9 | |
| d1soxa2 | 91 | Sulfite oxidase, N-terminal domain {Chicken (Gallu | 99.88 | |
| d1kbia2 | 97 | Flavocytochrome b2, N-terminal domain {Baker's yea | 99.87 | |
| d1tvca2 | 141 | Methane monooxygenase component C, MmoC {Methyloco | 99.86 | |
| d1mj4a_ | 80 | Sulfite oxidase, N-terminal domain {Human (Homo sa | 99.86 | |
| d1krha2 | 133 | Benzoate dioxygenase reductase {Acinetobacter sp. | 99.83 | |
| d1cqxa3 | 142 | Flavohemoglobin, C-terminal domain {Alcaligenes eu | 99.8 | |
| d1fdra1 | 99 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.79 | |
| d1umka2 | 147 | cytochrome b5 reductase {Human (Homo sapiens) [Tax | 99.78 | |
| d2cnda1 | 114 | Nitrate reductase core domain {Corn (Zea mays) [Ta | 99.78 | |
| d1umka1 | 124 | cytochrome b5 reductase {Human (Homo sapiens) [Tax | 99.78 | |
| d1gvha3 | 143 | Flavohemoglobin, C-terminal domain {Escherichia co | 99.77 | |
| d1a8pa1 | 99 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.77 | |
| d1qfja2 | 135 | NAD(P)H:flavin oxidoreductase {Escherichia coli [T | 99.76 | |
| d1cqxa2 | 111 | Flavohemoglobin, central domain {Alcaligenes eutro | 99.75 | |
| d1fdra2 | 148 | Ferredoxin reductase (flavodoxin reductase) {Esche | 99.75 | |
| d1gvha2 | 107 | Flavohemoglobin, central domain {Escherichia coli | 99.74 | |
| d2cnda2 | 146 | Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} | 99.73 | |
| d1fnda2 | 160 | Ferredoxin reductase (flavodoxin reductase) {Spina | 99.72 | |
| d1krha1 | 100 | Benzoate dioxygenase reductase {Acinetobacter sp. | 99.71 | |
| d2piaa2 | 120 | Phthalate dioxygenase reductase {Pseudomonas cepac | 99.7 | |
| d1jb9a2 | 154 | Ferredoxin reductase (flavodoxin reductase) {Maize | 99.69 | |
| d1f20a2 | 165 | Neuronal nitric-oxide synthase FAD/NADP+ domain {R | 99.69 | |
| d2bmwa2 | 162 | Ferredoxin reductase (flavodoxin reductase) {Cyano | 99.68 | |
| d1ja1a3 | 160 | NADPH-cytochrome p450 reductase {Rat (Rattus norve | 99.66 | |
| d2piaa1 | 103 | Phthalate dioxygenase reductase {Pseudomonas cepac | 99.65 | |
| d1qfja1 | 97 | NAD(P)H:flavin oxidoreductase {Escherichia coli [T | 99.65 | |
| d1ep3b1 | 101 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 99.65 | |
| d1tvca1 | 109 | Methane monooxygenase component C, MmoC {Methyloco | 99.64 | |
| d1a8pa2 | 158 | Ferredoxin reductase (flavodoxin reductase) {Azoto | 99.64 | |
| d1ep3b2 | 160 | Dihydroorotate dehydrogenase B, PyrK subunit {Lact | 99.56 | |
| d1ddga2 | 153 | Sulfite reductase flavoprotein {Escherichia coli [ | 99.53 | |
| d2bmwa1 | 133 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.45 | |
| d1fnda1 | 136 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.42 | |
| d1jb9a1 | 157 | Ferredoxin reductase (flavodoxin reductase) N-term | 99.02 | |
| d1t0ga_ | 109 | Putative steroid binding protein AT2G24940 {Thale | 98.08 | |
| d1rl1a_ | 92 | Suppressor of G2 allele of skp1 homolog, gst1 {Hum | 97.03 | |
| d1wh0a_ | 134 | Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H | 95.7 | |
| d1f20a1 | 270 | Neuronal nitric-oxide synthase FAD/NADP+ domain {R | 93.86 | |
| d1ddga1 | 221 | Sulfite reductase flavoprotein {Escherichia coli [ | 93.17 | |
| d1ejfa_ | 110 | Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 | 87.0 |
| >d1euea_ d.120.1.1 (A:) Cytochrome b5 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cytochrome b5-like heme/steroid binding domain superfamily: Cytochrome b5-like heme/steroid binding domain family: Cytochrome b5 domain: Cytochrome b5 species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.92 E-value=4.7e-26 Score=184.46 Aligned_cols=78 Identities=32% Similarity=0.602 Sum_probs=75.3
Q ss_pred cCHHHHhcccCCCCeEEEEcCEEEecccCcccccccccccccccccccchhhhccCCchhHHHhhhcCeeeEeCCCCC
Q psy8246 50 VSKAQLAEHNKEDDMWMCIRGVVYNVTRYMDFHPGGREELMRGAGMDATELFNKVHPWVNYESILQKCIVGKMGSSLP 127 (527)
Q Consensus 50 ~t~~e~~~h~~~~~~wvii~g~VYDvt~f~~~HPGG~~~l~~~aG~D~T~~f~~~h~~~~~~~~l~~~~vG~l~~~~~ 127 (527)
||++||++||++++|||+|+|+|||||+|+..||||.++|+.++|+|+|+.|+.+||+..++++|++|+||+|.+++.
T Consensus 7 yt~~Ev~~H~~~~d~Wvii~g~VYDvT~f~~~HPGG~~~i~~~aG~D~T~~f~~~hhs~~a~~~l~~~~IG~l~~~~~ 84 (86)
T d1euea_ 7 YRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEILLEQAGADATESFEDIGHSPDAREMLKQYYIGDVHPNDL 84 (86)
T ss_dssp ECHHHHTTCEETTEEEEEETTEEEECGGGGGGCTTCSHHHHTTTTSBCHHHHHHHTCCHHHHHHGGGGEEEEECGGGC
T ss_pred ECHHHHHhhCCCCCEEEEECCEEEecceeeeccCcchHHHHHHCCcCHHHHHHHhCCCHHHHHHHHhCcceEECcccC
Confidence 999999999999999999999999999999999999999999999999999999999999999999999999987654
|
| >d1cyoa_ d.120.1.1 (A:) Cytochrome b5 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1cxya_ d.120.1.1 (A:) Cytochrome b558 {Ectothiorhodospira vacuolata [TaxId: 1054]} | Back information, alignment and structure |
|---|
| >d1soxa2 d.120.1.1 (A:3-93) Sulfite oxidase, N-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1kbia2 d.120.1.1 (A:1-97) Flavocytochrome b2, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tvca2 c.25.1.2 (A:111-251) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d1mj4a_ d.120.1.1 (A:) Sulfite oxidase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1krha2 c.25.1.2 (A:206-338) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d1cqxa3 c.25.1.5 (A:262-403) Flavohemoglobin, C-terminal domain {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1fdra1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1umka2 c.25.1.1 (A:154-300) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cnda1 b.43.4.2 (A:11-124) Nitrate reductase core domain {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1umka1 b.43.4.2 (A:30-153) cytochrome b5 reductase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gvha3 c.25.1.5 (A:254-396) Flavohemoglobin, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1a8pa1 b.43.4.2 (A:2-100) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1qfja2 c.25.1.1 (A:98-232) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1cqxa2 b.43.4.2 (A:151-261) Flavohemoglobin, central domain {Alcaligenes eutrophus [TaxId: 106590]} | Back information, alignment and structure |
|---|
| >d1fdra2 c.25.1.1 (A:101-248) Ferredoxin reductase (flavodoxin reductase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gvha2 b.43.4.2 (A:147-253) Flavohemoglobin, central domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cnda2 c.25.1.1 (A:125-270) Nitrate reductase {Corn (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1fnda2 c.25.1.1 (A:155-314) Ferredoxin reductase (flavodoxin reductase) {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1krha1 b.43.4.2 (A:106-205) Benzoate dioxygenase reductase {Acinetobacter sp. [TaxId: 472]} | Back information, alignment and structure |
|---|
| >d2piaa2 c.25.1.2 (A:104-223) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1jb9a2 c.25.1.1 (A:163-316) Ferredoxin reductase (flavodoxin reductase) {Maize (Zea mays), root isoform [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1f20a2 c.25.1.4 (A:1233-1397) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2bmwa2 c.25.1.1 (A:142-303) Ferredoxin reductase (flavodoxin reductase) {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1ja1a3 c.25.1.4 (A:519-678) NADPH-cytochrome p450 reductase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2piaa1 b.43.4.2 (A:1-103) Phthalate dioxygenase reductase {Pseudomonas cepacia, db01 [TaxId: 292]} | Back information, alignment and structure |
|---|
| >d1qfja1 b.43.4.2 (A:1-97) NAD(P)H:flavin oxidoreductase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ep3b1 b.43.4.2 (B:2-102) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1tvca1 b.43.4.2 (A:2-110) Methane monooxygenase component C, MmoC {Methylococcus capsulatus [TaxId: 414]} | Back information, alignment and structure |
|---|
| >d1a8pa2 c.25.1.1 (A:101-258) Ferredoxin reductase (flavodoxin reductase) {Azotobacter vinelandii [TaxId: 354]} | Back information, alignment and structure |
|---|
| >d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1ddga2 c.25.1.4 (A:447-599) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bmwa1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Cyanobacterium (Anabaena sp.), pcc 7119 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1fnda1 b.43.4.2 (A:19-154) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1jb9a1 b.43.4.2 (A:6-162) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Maize (Zea mays), root isoform [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1t0ga_ d.120.1.2 (A:) Putative steroid binding protein AT2G24940 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f20a1 b.43.4.1 (A:963-1232) Neuronal nitric-oxide synthase FAD/NADP+ domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ddga1 b.43.4.1 (A:226-446) Sulfite reductase flavoprotein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|