Diaphorina citri psyllid: psy8249

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--

MSVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDNLEKLPVNPN

cCEEEEEccccEEEEEEcccccHHHHHHHHHHHcccccccEEEEcccccccEECccccccccEEEEcccccHHHHHHHHHHHHcccccccccEEEccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHcccccccccccccEEEEEEEEEcccccccccccccccccccccccccccc

*SVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDNL********

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Peptidyl-prolyl cis-trans isomerase-like 3	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.	confident	Q5ZLV2
Peptidyl-prolyl cis-trans isomerase-like 3	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.	confident	Q9D6L8
Peptidyl-prolyl cis-trans isomerase-like 3	PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.	confident	Q812D3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0000413 [BP]	protein peptidyl-prolyl isomerization	probable	GO:0044267, GO:0018208, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0071013 [CC]	catalytic step 2 spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0022626 [CC]	cytosolic ribosome	probable	GO:0005737, GO:0032991, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0044445, GO:0044424, GO:0043228, GO:0005622, GO:0043226
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006457 [BP]	protein folding	probable	GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0016607 [CC]	nuclear speck	probable	GO:0044446, GO:0016604, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0005575, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422
GO:0009941 [CC]	chloroplast envelope	probable	GO:0009526, GO:0005737, GO:0009536, GO:0005575, GO:0043231, GO:0044464, GO:0043229, GO:0031967, GO:0031975, GO:0044446, GO:0044444, GO:0005623, GO:0044435, GO:0044434, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0043021 [MF]	ribonucleoprotein complex binding	probable	GO:0003674, GO:0005488
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0003006 [BP]	developmental process involved in reproduction	probable	GO:0032502, GO:0022414, GO:0008150, GO:0000003
GO:0071011 [CC]	precatalytic spliceosome	probable	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:2000241 [BP]	regulation of reproductive process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0071001 [CC]	U4/U6 snRNP	probable	GO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0009570 [CC]	chloroplast stroma	probable	GO:0005737, GO:0005575, GO:0009536, GO:0043231, GO:0009532, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044435, GO:0044434, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0009507
GO:0051649 [BP]	establishment of localization in cell	probable	GO:0009987, GO:0008150, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0042393 [MF]	histone binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0000209 [BP]	protein polyubiquitination	probable	GO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0031090 [CC]	organelle membrane	probable	GO:0005575, GO:0016020, GO:0043227, GO:0043226, GO:0044422
GO:0048046 [CC]	apoplast	probable	GO:0005575, GO:0005576
GO:0009535 [CC]	chloroplast thylakoid membrane	probable	GO:0055035, GO:0034357, GO:0031976, GO:0043229, GO:0043227, GO:0043226, GO:0009579, GO:0009534, GO:0009536, GO:0016020, GO:0044436, GO:0044435, GO:0044434, GO:0005737, GO:0044446, GO:0031984, GO:0042651, GO:0009507, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044422
GO:0006996 [BP]	organelle organization	probable	GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0006397 [BP]	mRNA processing	probable	GO:0016070, GO:0016071, GO:0044238, GO:0044260, GO:0006139, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0031977 [CC]	thylakoid lumen	probable	GO:0009579, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044436, GO:0044424
GO:0006810 [BP]	transport	probable	GO:0051234, GO:0008150, GO:0051179
GO:0016018 [MF]	cyclosporin A binding	probable	GO:0033218, GO:0003674, GO:0042277, GO:0005488, GO:0008144
GO:0005740 [CC]	mitochondrial envelope	probable	GO:0031967, GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0031975, GO:0044446, GO:0044444, GO:0044429, GO:0005575, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051082 [MF]	unfolded protein binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0003755 [MF]	peptidyl-prolyl cis-trans isomerase activity	probable	GO:0003824, GO:0003674, GO:0016853, GO:0016859
GO:0005794 [CC]	Golgi apparatus	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0065008 [BP]	regulation of biological quality	probable	GO:0008150, GO:0065007
GO:0009792 [BP]	embryo development ending in birth or egg hatching	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0001666 [BP]	response to hypoxia	probable	GO:0009628, GO:0036293, GO:0050896, GO:0006950, GO:0008150, GO:0070482
GO:0008380 [BP]	RNA splicing	probable	GO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0034641, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0010467, GO:0006807, GO:0008150, GO:1901360, GO:0008152, GO:0006396, GO:0046483
GO:0046540 [CC]	U4/U6 x U5 tri-snRNP complex	probable	GO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0003682 [MF]	chromatin binding	probable	GO:0003674, GO:0005488
GO:0034450 [MF]	ubiquitin-ubiquitin ligase activity	probable	GO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

EC Number	Description	Confidence Level
5.-.-.-	Isomerases.	probable
5.2.-.-	Cis-trans-isomerases.	probable
5.2.1.-	Cis-trans Isomerases.	probable
5.2.1.8	Peptidylprolyl isomerase.	probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2K7N, chain A
Confidence level:very confident
Coverage over the Query: 1-61,112-203
View the alignment between query and template
View the model in PyMOL

Template: 3RFY, chain A
Confidence level:very confident
Coverage over the Query: 3-184
View the alignment between query and template
View the model in PyMOL

Template: 2POE, chain A
Confidence level:very confident
Coverage over the Query: 57-136,154-231
View the alignment between query and template
View the model in PyMOL