Psyllid ID: psy8249


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230--
MSVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDNLEKLPVNPN
cEEEEEEccccEEEEEEcccccHHHHHHHHHHHcccccccEEEEcccccccEEEccccccccEEEEcccccHHHHHHHHHHHHcccccccccEEEccccEEEcccccccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccccccEEEEEEccHHHHHHHHcccccccccccccEEEEEEEEEcccccccccccccccccccccccccccc
ccEEEEEccEEEEEEEcccccHHHHHHHHHHHHccccccEEEEEEEcccEEEEcccEccEEEEEEEcccccHHHHHHHHHHHHccccccEEEEEEEcccEEEEcccccccccccEccEccEccccccccccccccEEEEcccccccEcccEEEEccccHHHcccccEEEEEEEcHHHHHHHHcccEcccccEcccEEEEEEEEEEEEEEEEccccccccccccccccccccc
msvslhtdvgdikIELFCEDCPKTCENFLALCASdyyngcifhrNIKGfivqtgdpthtgdikielfcEDCPKTCENFLALCASdyyngcifhrNIKGfivqtgdpthtgkggnsiwgkkFEDEFKETLKHSERGIVSmanngpntnasQFFITYAAHAHLDLKYTIFGKVIdgfetldnleklpvnpnhkpiFFITYAAHAHLDLKYTIFGKVIdgletldnleklpvnpn
msvslhtdvgdikiELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPthtgkggnsiwgkKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLetldnleklpvnpn
MSVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDNLEKLPVNPN
******TDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFE************************NASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDN*********
*SVSLHTDVGDIKIELFCEDCPKTCENFLAL******************IVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDNL********
********VGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDNLEKLPVNPN
*SVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVI**LETLDNLEKL*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAHLDLKYTIFGKVIDGLETLDNLEKLPVNPN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query232 2.2.26 [Sep-21-2011]
Q9H2H8161 Peptidyl-prolyl cis-trans yes N/A 0.590 0.850 0.782 3e-60
Q5ZLV2161 Peptidyl-prolyl cis-trans yes N/A 0.590 0.850 0.789 3e-60
Q812D3161 Peptidyl-prolyl cis-trans yes N/A 0.590 0.850 0.768 1e-59
Q9D6L8161 Peptidyl-prolyl cis-trans yes N/A 0.590 0.850 0.760 4e-59
P52017161 Peptidyl-prolyl cis-trans yes N/A 0.590 0.850 0.715 4e-56
P0CP86167 Peptidyl-prolyl cis-trans yes N/A 0.590 0.820 0.664 6e-53
P0CP87167 Peptidyl-prolyl cis-trans N/A N/A 0.590 0.820 0.664 6e-53
P0C1I5170 Peptidyl-prolyl cis-trans N/A N/A 0.642 0.876 0.551 8e-53
Q54E95161 Peptidyl-prolyl cis-trans yes N/A 0.590 0.850 0.620 3e-47
Q4PCH8168 Peptidyl-prolyl cis-trans N/A N/A 0.586 0.809 0.597 6e-44
>sp|Q9H2H8|PPIL3_HUMAN Peptidyl-prolyl cis-trans isomerase-like 3 OS=Homo sapiens GN=PPIL3 PE=1 SV=1 Back     alignment and function desciption
 Score =  231 bits (589), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 120/138 (86%), Gaps = 1/138 (0%)

Query: 57  THTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSI 116
           T  GDIKIE+FCE  PKTCENFLALCAS+YYNGCIFHRNIKGF+VQTGDPT TG+GGNSI
Sbjct: 7   TDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSI 66

Query: 117 WGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFE 176
           WGKKFEDE+ E LKH+ RG+VSMANNGPNTN SQFFITY    HLD+KYT+FGKVIDG E
Sbjct: 67  WGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLE 126

Query: 177 TLDNLEKLPVN-PNHKPI 193
           TLD LEKLPVN   ++P+
Sbjct: 127 TLDELEKLPVNEKTYRPL 144




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides. May be involved in pre-mRNA splicing.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q5ZLV2|PPIL3_CHICK Peptidyl-prolyl cis-trans isomerase-like 3 OS=Gallus gallus GN=PPIL3 PE=2 SV=1 Back     alignment and function description
>sp|Q812D3|PPIL3_RAT Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rattus norvegicus GN=Ppil3 PE=2 SV=1 Back     alignment and function description
>sp|Q9D6L8|PPIL3_MOUSE Peptidyl-prolyl cis-trans isomerase-like 3 OS=Mus musculus GN=Ppil3 PE=2 SV=1 Back     alignment and function description
>sp|P52017|CYP10_CAEEL Peptidyl-prolyl cis-trans isomerase 10 OS=Caenorhabditis elegans GN=cyn-10 PE=2 SV=2 Back     alignment and function description
>sp|P0CP86|PPIL3_CRYNJ Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=CYP10 PE=3 SV=1 Back     alignment and function description
>sp|P0CP87|PPIL3_CRYNB Peptidyl-prolyl cis-trans isomerase-like 3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=CYP10 PE=3 SV=1 Back     alignment and function description
>sp|P0C1I5|PPIL3_RHIO9 Peptidyl-prolyl cis-trans isomerase-like 3 OS=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) GN=cyp4 PE=3 SV=1 Back     alignment and function description
>sp|Q54E95|PPIL3_DICDI Peptidyl-prolyl cis-trans isomerase-like 3 OS=Dictyostelium discoideum GN=ppil3 PE=3 SV=1 Back     alignment and function description
>sp|Q4PCH8|PPIL3_USTMA Peptidyl-prolyl cis-trans isomerase-like 3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CYP10 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
242247236161 cyclophilin-10-like [Acyrthosiphon pisum 0.590 0.850 0.826 2e-62
157107329161 cyclophilin-10 [Aedes aegypti] gi|108879 0.590 0.850 0.826 4e-62
91077922172 PREDICTED: similar to AGAP009996-PA [Tri 0.590 0.796 0.826 5e-61
340711065161 PREDICTED: peptidyl-prolyl cis-trans iso 0.590 0.850 0.804 1e-60
357619503161 putative cyclophilin-10 [Danaus plexippu 0.590 0.850 0.804 2e-60
390464717328 PREDICTED: peptidyl-prolyl cis-trans iso 0.590 0.417 0.789 3e-60
345493781161 PREDICTED: peptidyl-prolyl cis-trans iso 0.590 0.850 0.811 5e-60
307176780161 Peptidyl-prolyl cis-trans isomerase-like 0.590 0.850 0.804 8e-60
350405564161 PREDICTED: peptidyl-prolyl cis-trans iso 0.590 0.850 0.797 9e-60
170052053161 peptidyl-prolyl cis-trans isomerase 10 [ 0.590 0.850 0.789 1e-59
>gi|242247236|ref|NP_001156057.1| cyclophilin-10-like [Acyrthosiphon pisum] gi|239791807|dbj|BAH72320.1| ACYPI000589 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/138 (82%), Positives = 125/138 (90%), Gaps = 1/138 (0%)

Query: 57  THTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSI 116
           T  GDIKIE+FCE+CPKT ENFLALCASDYYNGC+FHRNIKGFIVQTGDPTHTGKGG+SI
Sbjct: 7   TDVGDIKIEVFCEECPKTAENFLALCASDYYNGCLFHRNIKGFIVQTGDPTHTGKGGSSI 66

Query: 117 WGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFE 176
           WG+KFEDEFKE LKH ERG VSMANNGPNTN+SQFF+TYAA  +LDLKYT+FG+VIDGFE
Sbjct: 67  WGRKFEDEFKENLKHKERGTVSMANNGPNTNSSQFFLTYAAQPNLDLKYTVFGRVIDGFE 126

Query: 177 TLDNLEKLPVNP-NHKPI 193
            LD LEKLPVN  N KP+
Sbjct: 127 ALDELEKLPVNSKNFKPL 144




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157107329|ref|XP_001649729.1| cyclophilin-10 [Aedes aegypti] gi|108879606|gb|EAT43831.1| AAEL004779-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91077922|ref|XP_974063.1| PREDICTED: similar to AGAP009996-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340711065|ref|XP_003394102.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|357619503|gb|EHJ72048.1| putative cyclophilin-10 [Danaus plexippus] Back     alignment and taxonomy information
>gi|390464717|ref|XP_002749663.2| PREDICTED: peptidyl-prolyl cis-trans isomerase C isoform 1 [Callithrix jacchus] Back     alignment and taxonomy information
>gi|345493781|ref|XP_001605618.2| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like isoform 1 [Nasonia vitripennis] gi|345493783|ref|XP_003427152.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like isoform 2 [Nasonia vitripennis] gi|345493785|ref|XP_003427153.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307176780|gb|EFN66180.1| Peptidyl-prolyl cis-trans isomerase-like 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350405564|ref|XP_003487479.1| PREDICTED: peptidyl-prolyl cis-trans isomerase-like 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170052053|ref|XP_001862046.1| peptidyl-prolyl cis-trans isomerase 10 [Culex quinquefasciatus] gi|170073840|ref|XP_001870450.1| peptidyl-prolyl cis-trans isomerase cyp8 [Culex quinquefasciatus] gi|167870550|gb|EDS33933.1| peptidyl-prolyl cis-trans isomerase cyp8 [Culex quinquefasciatus] gi|167873071|gb|EDS36454.1| peptidyl-prolyl cis-trans isomerase 10 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query232
FB|FBgn0033527161 CG11777 [Drosophila melanogast 0.586 0.844 0.781 5.7e-59
UNIPROTKB|H7BZ14180 PPIL3 "Peptidyl-prolyl cis-tra 0.698 0.9 0.698 1.2e-58
UNIPROTKB|Q9H2H8161 PPIL3 "Peptidyl-prolyl cis-tra 0.590 0.850 0.782 1.9e-58
UNIPROTKB|F2Z5T7161 PPIL3 "Peptidyl-prolyl cis-tra 0.590 0.850 0.782 1.9e-58
UNIPROTKB|J9NZK4160 PPIL3 "Peptidyl-prolyl cis-tra 0.590 0.856 0.782 1.9e-58
UNIPROTKB|Q5ZLV2161 PPIL3 "Peptidyl-prolyl cis-tra 0.590 0.850 0.789 2.5e-58
UNIPROTKB|J9P7M4161 J9P7M4 "Peptidyl-prolyl cis-tr 0.564 0.813 0.816 4e-58
RGD|631415161 Ppil3 "peptidylprolyl isomeras 0.590 0.850 0.768 8.4e-58
MGI|MGI:1917475161 Ppil3 "peptidylprolyl isomeras 0.590 0.850 0.760 3.6e-57
ZFIN|ZDB-GENE-040625-159161 zgc:86715 "zgc:86715" [Danio r 0.564 0.813 0.786 1.6e-56
FB|FBgn0033527 CG11777 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 605 (218.0 bits), Expect = 5.7e-59, P = 5.7e-59
 Identities = 107/137 (78%), Positives = 124/137 (90%)

Query:    57 THTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSI 116
             T  GD+KIELFC+ CPK CENFLALCASDYY+GC+F RNIKGFIVQTGDPT+TGK G SI
Sbjct:     7 TDVGDLKIELFCDACPKACENFLALCASDYYSGCVFIRNIKGFIVQTGDPTNTGKNGQSI 66

Query:   117 WGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFE 176
             WG+KF+DEFKET+KH++RG+VSMANNGPN NASQFFITYAA  +LDLKYT+FG+VIDGF+
Sbjct:    67 WGQKFDDEFKETIKHTDRGMVSMANNGPNANASQFFITYAAQPNLDLKYTLFGRVIDGFD 126

Query:   177 TLDNLEKLPVNP-NHKP 192
              LD LEKLPVNP N++P
Sbjct:   127 ALDELEKLPVNPKNYRP 143


GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS
GO:0006457 "protein folding" evidence=IEA
UNIPROTKB|H7BZ14 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9H2H8 PPIL3 "Peptidyl-prolyl cis-trans isomerase-like 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z5T7 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZK4 PPIL3 "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZLV2 PPIL3 "Peptidyl-prolyl cis-trans isomerase-like 3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9P7M4 J9P7M4 "Peptidyl-prolyl cis-trans isomerase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|631415 Ppil3 "peptidylprolyl isomerase (cyclophilin)-like 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1917475 Ppil3 "peptidylprolyl isomerase (cyclophilin)-like 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040625-159 zgc:86715 "zgc:86715" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZLV2PPIL3_CHICK5, ., 2, ., 1, ., 80.78980.59050.8509yesN/A
Q9D6L8PPIL3_MOUSE5, ., 2, ., 1, ., 80.76080.59050.8509yesN/A
Q4WVU5PPIL2_ASPFU5, ., 2, ., 1, ., 80.53690.61200.2452yesN/A
Q09928PPIL2_SCHPO5, ., 2, ., 1, ., 80.55140.58620.2635yesN/A
Q54E95PPIL3_DICDI5, ., 2, ., 1, ., 80.62040.59050.8509yesN/A
Q812D3PPIL3_RAT5, ., 2, ., 1, ., 80.76810.59050.8509yesN/A
Q9H2H8PPIL3_HUMAN5, ., 2, ., 1, ., 80.78260.59050.8509yesN/A
Q5AXT6PPIL2_EMENI5, ., 2, ., 1, ., 80.50280.69390.2775yesN/A
P52017CYP10_CAEEL5, ., 2, ., 1, ., 80.71530.59050.8509yesN/A
P0CP86PPIL3_CRYNJ5, ., 2, ., 1, ., 80.66420.59050.8203yesN/A
Q2U5W8PPIL2_ASPOR5, ., 2, ., 1, ., 80.57030.56460.2298yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.10.921
4th Layer5.2.1.80.914

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
cd01928153 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3 2e-93
cd01923159 cd01923, cyclophilin_RING, cyclophilin_RING: cyclo 2e-70
cd00317146 cd00317, cyclophilin, cyclophilin: cyclophilin-typ 5e-61
cd01927148 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclo 1e-59
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 2e-56
cd01922146 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCY 4e-52
cd01925171 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeC 1e-50
COG0652158 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase 5e-50
cd01921166 cd01921, cyclophilin_RRM, cyclophilin_RRM: cycloph 3e-46
cd01926164 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_lik 4e-46
PTZ00060183 PTZ00060, PTZ00060, cyclophilin; Provisional 3e-39
PLN03149186 PLN03149, PLN03149, peptidyl-prolyl isomerase H (c 7e-37
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 3e-24
pfam00160144 pfam00160, Pro_isomerase, Cyclophilin type peptidy 9e-24
PRK10903190 PRK10903, PRK10903, peptidyl-prolyl cis-trans isom 1e-17
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 6e-17
cd01924176 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40 1e-16
PTZ00221249 PTZ00221, PTZ00221, cyclophilin; Provisional 7e-16
cd01920155 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP 4e-13
PRK10791164 PRK10791, PRK10791, peptidyl-prolyl cis-trans isom 7e-12
>gnl|CDD|238909 cd01928, Cyclophilin_PPIL3_like, Cyclophilin_PPIL3_like Back     alignment and domain information
 Score =  270 bits (692), Expect = 2e-93
 Identities = 112/137 (81%), Positives = 122/137 (89%)

Query: 57  THTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSI 116
           T+ GDIKIELFC+DCPK CENFLALCAS YYNGCIFHRNIKGF+VQTGDPT TGKGG SI
Sbjct: 7   TNLGDIKIELFCDDCPKACENFLALCASGYYNGCIFHRNIKGFMVQTGDPTGTGKGGESI 66

Query: 117 WGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFE 176
           WGKKFEDEF+ETLKH  RG+VSMANNGPNTN SQFFITYA   HLD KYT+FGKVIDGFE
Sbjct: 67  WGKKFEDEFRETLKHDSRGVVSMANNGPNTNGSQFFITYAKQPHLDGKYTVFGKVIDGFE 126

Query: 177 TLDNLEKLPVNPNHKPI 193
           TLD LEKLPV+  ++P+
Sbjct: 127 TLDTLEKLPVDKKYRPL 143


Proteins similar to Human cyclophilin-like peptidylprolyl cis- trans isomerase (PPIL3). Members of this family lack a key residue important for cyclosporin binding: the tryptophan residue corresponding to W121 in human hCyP-18a; most members have a histidine at this position. The exact function of the protein is not known. Length = 153

>gnl|CDD|238904 cd01923, cyclophilin_RING, cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>gnl|CDD|238194 cd00317, cyclophilin, cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>gnl|CDD|238908 cd01927, cyclophilin_WD40, cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|238903 cd01922, cyclophilin_SpCYP2_like, cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>gnl|CDD|238906 cd01925, cyclophilin_CeCYP16-like, cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>gnl|CDD|223725 COG0652, PpiB, Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238902 cd01921, cyclophilin_RRM, cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>gnl|CDD|238907 cd01926, cyclophilin_ABH_like, cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>gnl|CDD|240249 PTZ00060, PTZ00060, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|178694 PLN03149, PLN03149, peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|215759 pfam00160, Pro_isomerase, Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD Back     alignment and domain information
>gnl|CDD|182824 PRK10903, PRK10903, peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>gnl|CDD|238905 cd01924, cyclophilin_TLP40_like, cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>gnl|CDD|140248 PTZ00221, PTZ00221, cyclophilin; Provisional Back     alignment and domain information
>gnl|CDD|238901 cd01920, cyclophilin_EcCYP_like, cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>gnl|CDD|182734 PRK10791, PRK10791, peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 232
KOG0881|consensus164 100.0
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 100.0
KOG0884|consensus161 100.0
KOG0880|consensus217 100.0
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 100.0
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 100.0
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 100.0
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 100.0
KOG0546|consensus 372 100.0
KOG0882|consensus558 100.0
KOG0883|consensus518 100.0
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 100.0
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 100.0
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 100.0
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 100.0
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 100.0
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 100.0
KOG0415|consensus 479 100.0
PTZ00221249 cyclophilin; Provisional 100.0
PTZ00060183 cyclophilin; Provisional 100.0
KOG0879|consensus177 100.0
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 100.0
KOG0885|consensus 439 100.0
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 100.0
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 100.0
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 100.0
KOG0111|consensus298 100.0
KOG0865|consensus167 99.95
cd01921166 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type 99.91
COG0652158 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase 99.89
cd01924176 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyc 99.88
cd01927148 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-typ 99.88
cd01922146 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: c 99.87
cd01928153 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like. Pro 99.87
cd01920155 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyc 99.86
cd01923159 cyclophilin_RING cyclophilin_RING: cyclophilin-typ 99.86
PRK10791164 peptidyl-prolyl cis-trans isomerase B (rotamase B) 99.85
PLN03149186 peptidyl-prolyl isomerase H (cyclophilin H); Provi 99.84
PRK10903190 peptidyl-prolyl cis-trans isomerase A (rotamase A) 99.84
cd01926164 cyclophilin_ABH_like cyclophilin_ABH_like: Cycloph 99.84
cd00317146 cyclophilin cyclophilin: cyclophilin-type peptidyl 99.83
PTZ00060183 cyclophilin; Provisional 99.83
PTZ00221249 cyclophilin; Provisional 99.83
KOG0881|consensus164 99.82
KOG0884|consensus161 99.81
KOG0880|consensus217 99.8
cd01925171 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: 99.77
PF00160155 Pro_isomerase: Cyclophilin type peptidyl-prolyl ci 99.77
KOG0415|consensus 479 99.75
KOG0883|consensus 518 99.73
KOG0882|consensus558 99.67
KOG0879|consensus177 99.64
KOG0546|consensus 372 99.64
KOG0885|consensus 439 99.4
KOG0111|consensus298 98.98
KOG0865|consensus167 98.09
TIGR03268 503 methan_mark_3 putative methanogenesis marker prote 95.39
PRK00969 508 hypothetical protein; Provisional 95.21
COG4070 512 Predicted peptidyl-prolyl cis-trans isomerase (rot 91.93
TIGR03268503 methan_mark_3 putative methanogenesis marker prote 85.13
>KOG0881|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-48  Score=279.74  Aligned_cols=152  Identities=49%  Similarity=0.822  Sum_probs=143.7

Q ss_pred             EEEEEeCCeeEEEEeecCCCchhHHhHHHhhhcCcccceeeeeecceeEEeeCCCccccccceeccccCCCCcchhhhhh
Q psy8249           2 SVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLAL   81 (232)
Q Consensus         2 ~v~~~t~~G~i~i~L~~~~~p~~~~nf~~l~~~~~y~~~~f~rvi~~f~iq~Gd~t~~G~i~i~l~~~~~P~~~~~F~~l   81 (232)
                      .|.+|||+|.|++|||-+.||+||+||.+|++.+||++..|||+|++|||||||||..|+                    
T Consensus        11 ~V~LeTsmG~i~~ElY~kHaP~TC~NF~eLarrgYYn~v~FHRii~DFmiQGGDPTGTGR--------------------   70 (164)
T KOG0881|consen   11 NVTLETSMGKITLELYWKHAPRTCQNFAELARRGYYNGVIFHRIIKDFMIQGGDPTGTGR--------------------   70 (164)
T ss_pred             eEEEeecccceehhhhhhcCcHHHHHHHHHHhcccccceeeeehhhhheeecCCCCCCCC--------------------
Confidence            489999999999999999999999999999999999999999999999999999986665                    


Q ss_pred             ccCCCCCCceeEEeecCcEEEcCCCCCCCCCCCccCCCCCcccccccccccccceEEecccCCCcccceEEeeccCCCCC
Q psy8249          82 CASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHL  161 (232)
Q Consensus        82 ~~~~~y~g~~~~rv~~~~~vq~G~~~~~~~~~~~~~~~~~~~e~~~~l~~~~~g~v~~~~~~~~~~~s~f~itl~~~~~l  161 (232)
                                                    ++.|+||.+|.+|.++.|+|...|++|||+++|++++|||||||.+.+||
T Consensus        71 ------------------------------GGaSIYG~kF~DEi~~dLkhTGAGILsMANaGPnTNgSQFFiTLAPt~~L  120 (164)
T KOG0881|consen   71 ------------------------------GGASIYGDKFEDEIHSDLKHTGAGILSMANAGPNTNGSQFFITLAPTQWL  120 (164)
T ss_pred             ------------------------------CccccccchhhhhhhhhhcccchhhhhhhccCCCCCCceEEEEecCcccc
Confidence                                          45577888999999999999999999999999999999999999999999


Q ss_pred             CCCccEEEEEeeccchhhhcccCCCCCCCCceeeEEEeeeee
Q psy8249         162 DLKYTIFGKVIDGFETLDNLEKLPVNPNHKPIFFITYAAHAH  203 (232)
Q Consensus       162 d~~~tvfG~VveG~dvl~~I~~~~~~~~~~P~~~i~I~~~~~  203 (232)
                      |++|++||||+.||+|+.++-.+.+++++||..+++|..+-.
T Consensus       121 DGKHTIFGRV~~Gm~vikr~G~v~Td~~DRPi~~~kIika~~  162 (164)
T KOG0881|consen  121 DGKHTIFGRVCSGMEVIKRMGMVETDNSDRPIDEVKIIKAYP  162 (164)
T ss_pred             CCcceeehhhhhhHHHHHhhcceecCCCCCCccceeeEeeec
Confidence            999999999999999999999999999999999999986643



>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>KOG0880|consensus Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>cd01921 cyclophilin_RRM cyclophilin_RRM: cyclophilin-type peptidylprolyl cis- trans isomerase domain occuring with a C-terminal RNA recognition motif domain (RRM) Back     alignment and domain information
>COG0652 PpiB Peptidyl-prolyl cis-trans isomerase (rotamase) - cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01924 cyclophilin_TLP40_like cyclophilin_TLP40_like: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) similar ot the Spinach thylakoid lumen protein TLP40 Back     alignment and domain information
>cd01927 cyclophilin_WD40 cyclophilin_WD40: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a WD40 domain Back     alignment and domain information
>cd01922 cyclophilin_SpCYP2_like cyclophilin_SpCYP2_like: cyclophilin 2-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to Schizosaccharomyces pombe cyp-2 Back     alignment and domain information
>cd01928 Cyclophilin_PPIL3_like Cyclophilin_PPIL3_like Back     alignment and domain information
>cd01920 cyclophilin_EcCYP_like cyclophilin_EcCYP_like: cyclophilin-type A-like peptidylprolyl cis- trans isomerase (PPIase) domain similar to the cytosolic E Back     alignment and domain information
>cd01923 cyclophilin_RING cyclophilin_RING: cyclophilin-type peptidylprolyl cis- trans isomerases (cyclophilins) having a modified RING finger domain Back     alignment and domain information
>PRK10791 peptidyl-prolyl cis-trans isomerase B (rotamase B); Provisional Back     alignment and domain information
>PLN03149 peptidyl-prolyl isomerase H (cyclophilin H); Provisional Back     alignment and domain information
>PRK10903 peptidyl-prolyl cis-trans isomerase A (rotamase A); Provisional Back     alignment and domain information
>cd01926 cyclophilin_ABH_like cyclophilin_ABH_like: Cyclophilin A, B and H-like cyclophilin-type peptidylprolyl cis- trans isomerase (PPIase) domain Back     alignment and domain information
>cd00317 cyclophilin cyclophilin: cyclophilin-type peptidylprolyl cis- trans isomerases Back     alignment and domain information
>PTZ00060 cyclophilin; Provisional Back     alignment and domain information
>PTZ00221 cyclophilin; Provisional Back     alignment and domain information
>KOG0881|consensus Back     alignment and domain information
>KOG0884|consensus Back     alignment and domain information
>KOG0880|consensus Back     alignment and domain information
>cd01925 cyclophilin_CeCYP16-like cyclophilin_CeCYP16-like: cyclophilin-type peptidylprolyl cis- trans isomerase) (PPIase) domain similar to Caenorhabditis elegans cyclophilin 16 Back     alignment and domain information
>PF00160 Pro_isomerase: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD; InterPro: IPR002130 Cyclophilin [] is the major high-affinity binding protein in vertebrates for the immunosuppressive drug cyclosporin A (CSA), but is also found in other organisms Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0883|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG0879|consensus Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>KOG0885|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0865|consensus Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information
>PRK00969 hypothetical protein; Provisional Back     alignment and domain information
>COG4070 Predicted peptidyl-prolyl cis-trans isomerase (rotamase), cyclophilin family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03268 methan_mark_3 putative methanogenesis marker protein 3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2oju_A167 X-Ray Structure Of Complex Of Human Cyclophilin J W 2e-61
1xyh_A161 Crystal Structure Of Recombinant Human Cyclophilin 2e-61
2poe_A185 Crystal Structure Of Cryptosporidium Parvum Cycloph 1e-45
2b71_A196 Plasmodium Yoelii Cyclophilin-Like Protein Length = 2e-36
2a2n_A176 Crystal Structure Of The Peptidylprolyl Isomerase D 2e-36
1zkc_A197 Crystal Structure Of The Cyclophiln_ring Domain Of 5e-36
2fu0_A160 Plasmodium Falciparum Cyclophilin Pfe0505w Putative 5e-35
1xwn_A174 Solution Structure Of Cyclophilin Like 1(Ppil1) And 1e-33
2x7k_A166 The Crystal Structure Of Ppil1 In Complex With Cycl 1e-33
2k7n_A203 Solution Structure Of The Ppil1 Bound To A Fragment 1e-33
2hq6_A185 Structure Of The Cyclophilin_cecyp16-like Domain Of 2e-31
1c5f_A177 Crystal Structure Of The Cyclophilin-Like Domain Fr 8e-27
3rdd_A184 Human Cyclophilin A Complexed With An Inhibitor Len 9e-27
2xgy_B173 Complex Of Rabbit Endogenous Lentivirus (Relik)caps 9e-27
2rmc_A182 Crystal Structure Of Murine Cyclophilin C Complexed 1e-26
1m9e_A164 X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- 1e-26
2rma_A165 Crystal Structures Of Cyclophilin A Complexed With 1e-26
1bck_A165 Human Cyclophilin A Complexed With 2-Thr Cyclospori 1e-26
5cyh_A164 Cyclophilin A Complexed With Dipeptide Gly-Pro Leng 1e-26
2haq_A172 Crystal Structure Of Cyclophilin A From Leishmania 1e-26
1qoi_A177 U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 2e-26
1qng_A170 Plasmodium Falciparum Cyclophilin Complexed With Cy 2e-26
3k0o_A165 Room Temperature Structure Of Cypa Mutant Ser99thr 2e-26
3k0r_A165 Cryogenic Structure Of Cypa Mutant Arg55lys Length 3e-26
3bt8_A172 Crystal Structure Of Mutant Cyclophilin (R147a) Fro 3e-26
2x83_B163 Evolutionary Basis Of Hiv Restriction By The Antire 3e-26
2wlw_A165 Structure Of The N-Terminal Capsid Domain Of Hiv-2 3e-26
2he9_A192 Structure Of The Peptidylprolyl Isomerase Domain Of 4e-26
2alf_A164 Crystal Structure Of Human Cypa Mutant K131a Length 4e-26
2x2c_K165 Acetyl-Cypa:cyclosporine Complex Length = 165 4e-26
2x2a_A165 Free Acetyl-Cypa Trigonal Form Length = 165 4e-26
4dgd_A165 Trimcyp Cyclophilin Domain From Macaca Mulatta: H70 4e-26
1ihg_A 370 Bovine Cyclophilin 40, Monoclinic Form Length = 370 5e-26
2x25_B169 Free Acetyl-Cypa Orthorhombic Form Length = 169 5e-26
2esl_A190 Human Cyclophilin C In Complex With Cyclosporin A L 6e-26
2wfj_A179 Atomic Resolution Crystal Structure Of The Ppiase D 8e-26
1qnh_A170 Plasmodium Falciparum Cyclophilin (Double Mutant) C 9e-26
2gw2_A198 Crystal Structure Of The Peptidyl-Prolyl Isomerase 2e-25
2hqj_A183 Cyclophilin From Leishmania Major Length = 183 2e-25
4frv_A185 Crystal Structure Of Mutated Cyclophilin B That Cau 3e-25
4fru_A185 Crystal Structure Of Horse Wild-Type Cyclophilin B 3e-25
1xo7_A166 Crystal Structure Of Cyclophilin From Trypanosoma C 5e-25
2cfe_A162 The 1.5 A Crystal Structure Of The Malassezia Sympo 5e-25
1aws_A164 Secypa Complexed With Hagpia (Pseudo-Symmetric Mono 8e-25
4i9y_A167 Structure Of The C-terminal Domain Of Nup358 Length 1e-24
2wfi_A179 Atomic Resolution Crystal Structure Of The Ppiase D 1e-24
2c3b_A172 The Crystal Structure Of Aspergillus Fumigatus Cycl 2e-24
1cyn_A178 Cyclophilin B Complexed With [d-(Cholinylester)ser8 2e-24
3ich_A188 Crystal Structure Of Cyclophilin B At 1.2 A Resolut 2e-24
2z6w_A165 Crystal Structure Of Human Cyclophilin D In Complex 3e-24
3r49_A166 Human Cyclophilin D Complexed With Quinolin-8-Amine 3e-24
2bit_X165 Crystal Structure Of Human Cyclophilin D At 1.7 A R 3e-24
3qyu_A164 Crystal Structure Of Human Cyclophilin D At 1.54 A 3e-24
1h0p_A182 Cyclophilin_5 From C. Elegans Length = 182 6e-24
3k2c_A193 Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isom 6e-24
2plu_A186 Crystal Structure Of Cryptosporidium Parvum Cycloph 9e-24
1ist_A162 Crystal Structure Of Yeast Cyclophilin A, Cpr1 Leng 1e-23
1z81_A229 Crystal Structure Of Cyclophilin From Plasmodium Yo 4e-23
2ck1_A172 The Structure Of Oxidised Cyclophilin A From S. Man 5e-23
3bo7_A201 Crystal Structure Of Toxoplasma Gondii Peptidyl-Pro 5e-23
3bkp_A232 Crystal Structure Of The Toxoplasma Gondii Cyclophi 5e-23
3pmp_A164 Crystal Structure Of Cyclophilin A From Moniliophth 7e-23
3o7t_A164 Crystal Structure Of Cyclophilin A From Moniliophth 7e-23
1dyw_A173 Biochemical And Structural Characterization Of A Di 1e-22
2r99_A173 Crystal Structure Of Cyclophilin Abh-Like Domain Of 2e-22
1zmf_A165 C Domain Of Human Cyclophilin-33(Hcyp33) Length = 1 2e-22
1w74_A191 X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomer 7e-21
3uch_A174 Crystal Structure Of A Hypotherical Peptidyl-Prolyl 9e-21
1j2a_A166 Structure Of E. Coli Cyclophilin B K163t Mutant Len 7e-14
1clh_A166 Three-Dimensional Solution Structure Of Escherichia 8e-14
2nul_A164 Peptidylprolyl Isomerase From E. Coli Length = 164 2e-12
1lop_A164 Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P 3e-12
3s6m_A167 The Structure Of A Peptidyl-Prolyl Cis-Trans Isomer 2e-11
3t1u_A163 Crystal Structure Of The Complex Of Cyclophilin-a E 5e-11
>pdb|2OJU|A Chain A, X-Ray Structure Of Complex Of Human Cyclophilin J With Cyclosporin A Length = 167 Back     alignment and structure

Iteration: 1

Score = 232 bits (591), Expect = 2e-61, Method: Compositional matrix adjust. Identities = 108/138 (78%), Positives = 120/138 (86%), Gaps = 1/138 (0%) Query: 57 THTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSI 116 T GDIKIE+FCE PKTCENFLALCAS+YYNGCIFHRNIKGF+VQTGDPT TG+GGNSI Sbjct: 13 TDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSI 72 Query: 117 WGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFE 176 WGKKFEDE+ E LKH+ RG+VSMANNGPNTN SQFFITY HLD+KYT+FGKVIDG E Sbjct: 73 WGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLE 132 Query: 177 TLDNLEKLPVN-PNHKPI 193 TLD LEKLPVN ++P+ Sbjct: 133 TLDELEKLPVNEKTYRPL 150
>pdb|1XYH|A Chain A, Crystal Structure Of Recombinant Human Cyclophilin J Length = 161 Back     alignment and structure
>pdb|2POE|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_1660 Length = 185 Back     alignment and structure
>pdb|2B71|A Chain A, Plasmodium Yoelii Cyclophilin-Like Protein Length = 196 Back     alignment and structure
>pdb|2A2N|A Chain A, Crystal Structure Of The Peptidylprolyl Isomerase Domain Of Human Ppwd1 Length = 176 Back     alignment and structure
>pdb|1ZKC|A Chain A, Crystal Structure Of The Cyclophiln_ring Domain Of Human Peptidylprolyl Isomerase (Cyclophilin)-Like 2 Isoform B Length = 197 Back     alignment and structure
>pdb|2FU0|A Chain A, Plasmodium Falciparum Cyclophilin Pfe0505w Putative Cyclosporin- Binding Domain Length = 160 Back     alignment and structure
>pdb|1XWN|A Chain A, Solution Structure Of Cyclophilin Like 1(Ppil1) And Insights Into Its Interaction With Skip Length = 174 Back     alignment and structure
>pdb|2X7K|A Chain A, The Crystal Structure Of Ppil1 In Complex With Cyclosporine A Suggests A Binding Mode For Skip Length = 166 Back     alignment and structure
>pdb|2K7N|A Chain A, Solution Structure Of The Ppil1 Bound To A Fragment Of Skip Length = 203 Back     alignment and structure
>pdb|2HQ6|A Chain A, Structure Of The Cyclophilin_cecyp16-like Domain Of The Serologically Defined Colon Cancer Antigen 10 From Homo Sapiens Length = 185 Back     alignment and structure
>pdb|1C5F|A Chain A, Crystal Structure Of The Cyclophilin-Like Domain From Brugia Malayi Complexed With Cyclosporin A Length = 177 Back     alignment and structure
>pdb|3RDD|A Chain A, Human Cyclophilin A Complexed With An Inhibitor Length = 184 Back     alignment and structure
>pdb|2XGY|B Chain B, Complex Of Rabbit Endogenous Lentivirus (Relik)capsid With Cyclophilin A Length = 173 Back     alignment and structure
>pdb|2RMC|A Chain A, Crystal Structure Of Murine Cyclophilin C Complexed With Immunosuppressive Drug Cyclosporin A Length = 182 Back     alignment and structure
>pdb|1M9E|A Chain A, X-Ray Crystal Structure Of Cyclophilin AHIV-1 Ca N- Terminal Domain (1-146) M-Type H87a Complex. Length = 164 Back     alignment and structure
>pdb|2RMA|A Chain A, Crystal Structures Of Cyclophilin A Complexed With Cyclosporin A And N-Methyl-4-[(E)-2-Butenyl]-4,4-Dimethylthreonine Cyclosporin A Length = 165 Back     alignment and structure
>pdb|1BCK|A Chain A, Human Cyclophilin A Complexed With 2-Thr Cyclosporin Length = 165 Back     alignment and structure
>pdb|5CYH|A Chain A, Cyclophilin A Complexed With Dipeptide Gly-Pro Length = 164 Back     alignment and structure
>pdb|2HAQ|A Chain A, Crystal Structure Of Cyclophilin A From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|1QOI|A Chain A, U4U6 SNRNP-Specific Cyclophilin Snucyp-20 Length = 177 Back     alignment and structure
>pdb|1QNG|A Chain A, Plasmodium Falciparum Cyclophilin Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|3K0O|A Chain A, Room Temperature Structure Of Cypa Mutant Ser99thr Length = 165 Back     alignment and structure
>pdb|3K0R|A Chain A, Cryogenic Structure Of Cypa Mutant Arg55lys Length = 165 Back     alignment and structure
>pdb|3BT8|A Chain A, Crystal Structure Of Mutant Cyclophilin (R147a) From Leishmania Donovani Length = 172 Back     alignment and structure
>pdb|2X83|B Chain B, Evolutionary Basis Of Hiv Restriction By The Antiretroviral Trimcyp Length = 163 Back     alignment and structure
>pdb|2WLW|A Chain A, Structure Of The N-Terminal Capsid Domain Of Hiv-2 Length = 165 Back     alignment and structure
>pdb|2HE9|A Chain A, Structure Of The Peptidylprolyl Isomerase Domain Of The Human Nk-Tumour Recognition Protein Length = 192 Back     alignment and structure
>pdb|2ALF|A Chain A, Crystal Structure Of Human Cypa Mutant K131a Length = 164 Back     alignment and structure
>pdb|2X2C|K Chain K, Acetyl-Cypa:cyclosporine Complex Length = 165 Back     alignment and structure
>pdb|2X2A|A Chain A, Free Acetyl-Cypa Trigonal Form Length = 165 Back     alignment and structure
>pdb|4DGD|A Chain A, Trimcyp Cyclophilin Domain From Macaca Mulatta: H70c Mutant Length = 165 Back     alignment and structure
>pdb|1IHG|A Chain A, Bovine Cyclophilin 40, Monoclinic Form Length = 370 Back     alignment and structure
>pdb|2X25|B Chain B, Free Acetyl-Cypa Orthorhombic Form Length = 169 Back     alignment and structure
>pdb|2ESL|A Chain A, Human Cyclophilin C In Complex With Cyclosporin A Length = 190 Back     alignment and structure
>pdb|2WFJ|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G In Complex With Cyclosporin A Length = 179 Back     alignment and structure
>pdb|1QNH|A Chain A, Plasmodium Falciparum Cyclophilin (Double Mutant) Complexed With Cyclosporin A Length = 170 Back     alignment and structure
>pdb|2GW2|A Chain A, Crystal Structure Of The Peptidyl-Prolyl Isomerase Domain Of Human Cyclophilin G Length = 198 Back     alignment and structure
>pdb|2HQJ|A Chain A, Cyclophilin From Leishmania Major Length = 183 Back     alignment and structure
>pdb|4FRV|A Chain A, Crystal Structure Of Mutated Cyclophilin B That Causes Hyperelastosis Cutis In The American Quarter Horse Length = 185 Back     alignment and structure
>pdb|4FRU|A Chain A, Crystal Structure Of Horse Wild-Type Cyclophilin B Length = 185 Back     alignment and structure
>pdb|1XO7|A Chain A, Crystal Structure Of Cyclophilin From Trypanosoma Cruzi Length = 166 Back     alignment and structure
>pdb|2CFE|A Chain A, The 1.5 A Crystal Structure Of The Malassezia Sympodialis Mala S 6 Allergen, A Member Of The Cyclophilin Pan- Allergen Family Length = 162 Back     alignment and structure
>pdb|1AWS|A Chain A, Secypa Complexed With Hagpia (Pseudo-Symmetric Monomer) Length = 164 Back     alignment and structure
>pdb|4I9Y|A Chain A, Structure Of The C-terminal Domain Of Nup358 Length = 167 Back     alignment and structure
>pdb|2WFI|A Chain A, Atomic Resolution Crystal Structure Of The Ppiase Domain Of Human Cyclophilin G Length = 179 Back     alignment and structure
>pdb|2C3B|A Chain A, The Crystal Structure Of Aspergillus Fumigatus Cyclophilin Reveals 3d Domain Swapping Of A Central Element Length = 172 Back     alignment and structure
>pdb|1CYN|A Chain A, Cyclophilin B Complexed With [d-(Cholinylester)ser8]-Cyclosporin Length = 178 Back     alignment and structure
>pdb|3ICH|A Chain A, Crystal Structure Of Cyclophilin B At 1.2 A Resolution Length = 188 Back     alignment and structure
>pdb|2Z6W|A Chain A, Crystal Structure Of Human Cyclophilin D In Complex With Cyclosporin A Length = 165 Back     alignment and structure
>pdb|3R49|A Chain A, Human Cyclophilin D Complexed With Quinolin-8-Amine Length = 166 Back     alignment and structure
>pdb|2BIT|X Chain X, Crystal Structure Of Human Cyclophilin D At 1.7 A Resolution Length = 165 Back     alignment and structure
>pdb|3QYU|A Chain A, Crystal Structure Of Human Cyclophilin D At 1.54 A Resolution At Room Temperature Length = 164 Back     alignment and structure
>pdb|1H0P|A Chain A, Cyclophilin_5 From C. Elegans Length = 182 Back     alignment and structure
>pdb|3K2C|A Chain A, Crystal Structure Of Peptidyl-Prolyl Cis-Trans Isomerase From Encephalitozoon Cuniculi At 1.9 A Resolution Length = 193 Back     alignment and structure
>pdb|2PLU|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cyclophilin Type Peptidyl-Prolyl Cis-Trans Isomerase Cgd2_4120 Length = 186 Back     alignment and structure
>pdb|1IST|A Chain A, Crystal Structure Of Yeast Cyclophilin A, Cpr1 Length = 162 Back     alignment and structure
>pdb|1Z81|A Chain A, Crystal Structure Of Cyclophilin From Plasmodium Yoelii Length = 229 Back     alignment and structure
>pdb|2CK1|A Chain A, The Structure Of Oxidised Cyclophilin A From S. Mansoni Length = 172 Back     alignment and structure
>pdb|3BO7|A Chain A, Crystal Structure Of Toxoplasma Gondii Peptidyl-Prolyl Cis-Trans Isomerase, 541.M00136 Length = 201 Back     alignment and structure
>pdb|3BKP|A Chain A, Crystal Structure Of The Toxoplasma Gondii Cyclophilin, 49.m03261 Length = 232 Back     alignment and structure
>pdb|3PMP|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa In Complex With Cyclosporin A Length = 164 Back     alignment and structure
>pdb|3O7T|A Chain A, Crystal Structure Of Cyclophilin A From Moniliophthora Perniciosa Length = 164 Back     alignment and structure
>pdb|1DYW|A Chain A, Biochemical And Structural Characterization Of A Divergent Loop Cyclophilin From Caenorhabditis Elegans Length = 173 Back     alignment and structure
>pdb|2R99|A Chain A, Crystal Structure Of Cyclophilin Abh-Like Domain Of Human Peptidylprolyl Isomerase E Isoform 1 Length = 173 Back     alignment and structure
>pdb|1ZMF|A Chain A, C Domain Of Human Cyclophilin-33(Hcyp33) Length = 165 Back     alignment and structure
>pdb|1W74|A Chain A, X-Ray Structure Of Peptidyl-Prolyl Cis-Trans Isomerase A, Ppia, Rv0009, From Mycobacterium Tuberculosis. Length = 191 Back     alignment and structure
>pdb|3UCH|A Chain A, Crystal Structure Of A Hypotherical Peptidyl-Prolyl Cis-Trans Isomerase E (Ppie) From Homo Sapiens At 2.50 A Resolution Length = 174 Back     alignment and structure
>pdb|1J2A|A Chain A, Structure Of E. Coli Cyclophilin B K163t Mutant Length = 166 Back     alignment and structure
>pdb|1CLH|A Chain A, Three-Dimensional Solution Structure Of Escherichia Coli Periplasmic Cyclophilin Length = 166 Back     alignment and structure
>pdb|2NUL|A Chain A, Peptidylprolyl Isomerase From E. Coli Length = 164 Back     alignment and structure
>pdb|1LOP|A Chain A, Cyclophilin A Complexed With Succinyl-Ala-Pro-Ala-P-Nitroanilide Length = 164 Back     alignment and structure
>pdb|3S6M|A Chain A, The Structure Of A Peptidyl-Prolyl Cis-Trans Isomerase From Burkholderia Pseudomallei Length = 167 Back     alignment and structure
>pdb|3T1U|A Chain A, Crystal Structure Of The Complex Of Cyclophilin-a Enzyme From Azotobacter Vinelandii With Sucafpfpna Peptide Length = 163 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query232
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 2e-89
2b71_A196 Cyclophilin-like protein; structural genomics, str 5e-89
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 2e-88
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 2e-88
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 7e-88
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 1e-87
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 1e-86
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 1e-86
2hq6_A185 Serologically defined colon cancer antigen 10; pro 2e-86
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 2e-84
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 5e-80
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 2e-69
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 3e-56
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 5e-56
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 8e-56
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 1e-55
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 2e-53
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 4e-52
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 7e-52
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 1e-51
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 1e-51
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 1e-51
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 6e-51
1z81_A229 Cyclophilin; structural genomics, structural genom 8e-51
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 2e-50
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 2e-50
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 3e-50
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 4e-50
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 8e-50
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 1e-49
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 6e-49
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 1e-48
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 4e-48
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 4e-47
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 2e-41
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 3e-38
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-05
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Length = 161 Back     alignment and structure
 Score =  259 bits (665), Expect = 2e-89
 Identities = 108/138 (78%), Positives = 120/138 (86%), Gaps = 1/138 (0%)

Query: 57  THTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSI 116
           T  GDIKIE+FCE  PKTCENFLALCAS+YYNGCIFHRNIKGF+VQTGDPT TG+GGNSI
Sbjct: 7   TDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSI 66

Query: 117 WGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFE 176
           WGKKFEDE+ E LKH+ RG+VSMANNGPNTN SQFFITY    HLD+KYT+FGKVIDG E
Sbjct: 67  WGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLE 126

Query: 177 TLDNLEKLPVNP-NHKPI 193
           TLD LEKLPVN   ++P+
Sbjct: 127 TLDELEKLPVNEKTYRPL 144


>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Length = 196 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Length = 166 Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Length = 160 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Length = 203 Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 176 Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Length = 185 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Length = 197 Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Length = 185 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Length = 201 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 232 Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Length = 191 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Length = 179 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Length = 192 Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Length = 177 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Length = 177 Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Length = 188 Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Length = 172 Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Length = 186 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Length = 170 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Length = 173 Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Length = 172 Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Length = 229 Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Length = 165 Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Length = 173 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Length = 193 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Length = 234 Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Length = 184 Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} PDB: 3o7t_A Length = 164 Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Length = 164 Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} PDB: 3t1u_A* Length = 167 Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Length = 172 Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Length = 166 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Length = 369 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 100.0
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 100.0
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 100.0
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 100.0
2b71_A196 Cyclophilin-like protein; structural genomics, str 100.0
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 100.0
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 100.0
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 100.0
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 100.0
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 100.0
2hq6_A185 Serologically defined colon cancer antigen 10; pro 100.0
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 100.0
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 100.0
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 100.0
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 100.0
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 100.0
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 100.0
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 100.0
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 100.0
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 100.0
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 100.0
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 100.0
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 100.0
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 100.0
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 100.0
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 100.0
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 100.0
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 100.0
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 100.0
1z81_A229 Cyclophilin; structural genomics, structural genom 100.0
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 100.0
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 100.0
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 100.0
3bo7_A201 Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; 99.88
2ok3_A161 Peptidyl-prolyl CIS-trans isomerase-like 3; beta-b 99.88
2fu0_A160 Cyclophilin, putative; PFE0505W, cyclosporin-bindi 99.88
2x7k_A166 Peptidyl-prolyl CIS-trans isomerase-like 1; isomer 99.88
2poe_A185 Cyclophilin-like protein, putative; cryptosporidiu 99.88
3pmp_A164 Cyclophilin A; peptidyl prolyl isomerase, isomeras 99.87
2wfi_A179 Peptidyl-prolyl CIS-trans isomerase G; phosphoprot 99.87
1zkc_A197 Peptidyl-prolyl CIS-trans isomerase like 2; CIS-tr 99.87
1a58_A177 Cyclophilin; isomerase, ppiase; 1.95A {Brugia mala 99.87
2haq_A172 Cyclophilin; rotamase, proline, isomerase, CIS-tra 99.87
1mzw_A177 Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyc 99.87
1w74_A191 Peptidyl-prolyl CIS-trans isomerase A; cyclophilin 99.87
2b71_A196 Cyclophilin-like protein; structural genomics, str 99.87
2he9_A192 NK-tumor recognition protein; cyclosporin, isomera 99.87
2a2n_A176 Peptidylprolyl isomerase domain and WD repeat CON; 99.87
2k7n_A203 Peptidyl-prolyl CIS-trans isomerase-like 1; beta b 99.87
3k2c_A193 Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, 99.86
2cmt_A172 Peptidyl-prolyl CIS-trans isomerase E; rotamase ac 99.86
4fru_A185 Cyclophilin B, peptidyl-prolyl CIS-trans isomerase 99.86
2z6w_A165 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 99.86
3s6m_A167 Peptidyl-prolyl CIS-trans isomerase; seattle struc 99.86
1v9t_A166 Cyclophilin B; beta barrel, isomerase-isomerase in 99.86
2r99_A173 Peptidyl-prolyl CIS-trans isomerase E; CIS-trans i 99.86
3rdd_A184 Peptidyl-prolyl CIS-trans isomerase A; beta barrel 99.86
1lop_A164 Cyclophilin A; rotamase, isomerase-isomerase inhib 99.86
3ich_A188 Peptidyl-prolyl CIS-trans isomerase B; beta sandwi 99.86
1qng_A170 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 99.86
2igv_A173 Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1 99.86
2poy_A186 Peptidyl-prolyl CIS-trans isomerase; isomerase-imm 99.85
1z81_A229 Cyclophilin; structural genomics, structural genom 99.83
3rfy_A369 Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; 99.82
2ose_A234 Probable peptidyl-prolyl CIS-trans isomerase; cycl 99.82
2c3b_A172 Ppiase, cyclophilin; isomerase, 3D domain swapping 99.82
3bkp_A232 Cyclophilin; malaria, isomerase, structural GENO s 99.81
1ihg_A 370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.79
2hq6_A185 Serologically defined colon cancer antigen 10; pro 99.79
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
Probab=100.00  E-value=4.7e-50  Score=310.04  Aligned_cols=159  Identities=72%  Similarity=1.200  Sum_probs=147.1

Q ss_pred             CEEEEEeCCeeEEEEeecCCCchhHHhHHHhhhcCcccceeeeeecceeEEeeCCCccccccceeccccCCCCcchhhhh
Q psy8249           1 MSVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLA   80 (232)
Q Consensus         1 ~~v~~~t~~G~i~i~L~~~~~p~~~~nf~~l~~~~~y~~~~f~rvi~~f~iq~Gd~t~~G~i~i~l~~~~~P~~~~~F~~   80 (232)
                      |+|+|+|++|+|+|+||++.||+|++||++||+.+||+++.||||+++||+||||++..|.                   
T Consensus         1 m~v~~~T~~G~i~ieL~~~~aP~t~~NF~~L~~~g~Y~g~~fhRvi~~f~iQgGd~~~~g~-------------------   61 (161)
T 2ok3_A            1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGR-------------------   61 (161)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSS-------------------
T ss_pred             CEEEEEeCCccEEEEEcCCCCcHHHHHHHHHhhhcccCCCEEEEEECCCEEecCCCCCCCC-------------------
Confidence            9999999999999999999999999999999999999999999999999999999863331                   


Q ss_pred             hccCCCCCCceeEEeecCcEEEcCCCCCCCCCCCccCCCCCcccccccccccccceEEecccCCCcccceEEeeccCCCC
Q psy8249          81 LCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAH  160 (232)
Q Consensus        81 l~~~~~y~g~~~~rv~~~~~vq~G~~~~~~~~~~~~~~~~~~~e~~~~l~~~~~g~v~~~~~~~~~~~s~f~itl~~~~~  160 (232)
                                                     ++.++++..+++|..+.++|+++|+|+||++++++++|||||+++++||
T Consensus        62 -------------------------------gg~si~g~~~~dE~~~~l~h~~~G~lsma~~gp~s~~SQFfI~~~~~~~  110 (161)
T 2ok3_A           62 -------------------------------GGNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPH  110 (161)
T ss_dssp             -------------------------------CCCCTTSSCBCCCCCTTCCSCSTTEEEECCSSTTCBCSCEEEESSCCGG
T ss_pred             -------------------------------CCCcccCCccccccCcCcCcCCCeEEEEecCCCCCcceEEEEEcCCCCc
Confidence                                           2235567778888877899999999999999999999999999999999


Q ss_pred             CCCCccEEEEEeeccchhhhcccCCCCCC-CCceeeEEEeeeeecCCCCc
Q psy8249         161 LDLKYTIFGKVIDGFETLDNLEKLPVNPN-HKPIFFITYAAHAHLDLKYT  209 (232)
Q Consensus       161 ld~~~tvfG~VveG~dvl~~I~~~~~~~~-~~P~~~i~I~~~~~ld~~~~  209 (232)
                      ||++|+|||+|++|||+|++|++++++++ ++|..+|+|.+|..++++|.
T Consensus       111 Ldg~~tvFG~Vv~G~dvv~~I~~~~~~~~~~~P~~~v~I~~~~i~~~Pf~  160 (161)
T 2ok3_A          111 LDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPFA  160 (161)
T ss_dssp             GTTTSCEEEEEEECHHHHHHHHTCCBCTTTCCBSSCCBEEEEEEECCSCC
T ss_pred             cCCCEeEEEEEeCCHHHHHHHHhCCccCCCCCcCCCeEEEEEEEecCCCC
Confidence            99999999999999999999999999987 99999999999999999874



>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>3bo7_A Peptidyl-prolyl CIS-trans isomerase cyclophilin-T; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, structural G structural genomics consortium, SGC; HET: BMT; 2.35A {Toxoplasma gondii} Back     alignment and structure
>2ok3_A Peptidyl-prolyl CIS-trans isomerase-like 3; beta-barrel, helix, disulfide bridge; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1xyh_A 2oju_A* Back     alignment and structure
>2fu0_A Cyclophilin, putative; PFE0505W, cyclosporin-binding domain, structura genomics, structural genomics consortium, SGC, unknown FUNC; 1.80A {Plasmodium falciparum} SCOP: b.62.1.1 Back     alignment and structure
>2x7k_A Peptidyl-prolyl CIS-trans isomerase-like 1; isomerase-immunosuppressant complex, immunosuppressant; HET: MLE MVA BMT ABA SAR; 1.15A {Homo sapiens} PDB: 1xwn_A Back     alignment and structure
>2poe_A Cyclophilin-like protein, putative; cryptosporidium parvum cyclophilin isomerase, structural genomics; 2.01A {Cryptosporidium parvum iowa II} PDB: 2qer_A Back     alignment and structure
>3pmp_A Cyclophilin A; peptidyl prolyl isomerase, isomerase-immunosuppressant compl; HET: BMT; 1.47A {Moniliophthora perniciosa} SCOP: b.62.1.1 PDB: 3o7t_A Back     alignment and structure
>2wfi_A Peptidyl-prolyl CIS-trans isomerase G; phosphoprotein, PRE-mRNA splicing, alternative splicing, nucleus, rotamase, cyclosporin; HET: OCS; 0.75A {Homo sapiens} PDB: 2wfj_A* 2gw2_A Back     alignment and structure
>1zkc_A Peptidyl-prolyl CIS-trans isomerase like 2; CIS-trans isomerization, peptidylprolyl isomerase, protein- folding, structural genomics consortium; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>1a58_A Cyclophilin; isomerase, ppiase; 1.95A {Brugia malayi} SCOP: b.62.1.1 PDB: 1a33_A 1c5f_A* Back     alignment and structure
>2haq_A Cyclophilin; rotamase, proline, isomerase, CIS-trans, protozoa, KAla-AZAR.; 1.97A {Leishmania donovani} PDB: 3eov_A* 3bt8_A Back     alignment and structure
>1mzw_A Cyclophilin H, U-snRNP-ASSOCIATED cyclophilin; cyclophilin, peptidyl-prolyl-CIS/trans isomerase, spliceosome, U4/U6-60K protein, WD protein; 2.00A {Homo sapiens} SCOP: b.62.1.1 PDB: 1qoi_A Back     alignment and structure
>1w74_A Peptidyl-prolyl CIS-trans isomerase A; cyclophilin, ppiase, RV0009, rotamase, structural proteomics in europe, spine; 2.6A {Mycobacterium tuberculosis} SCOP: b.62.1.1 Back     alignment and structure
>2b71_A Cyclophilin-like protein; structural genomics, structural genomics consortium, SGC, isomerase; 2.50A {Plasmodium yoelii} SCOP: b.62.1.1 Back     alignment and structure
>2he9_A NK-tumor recognition protein; cyclosporin, isomerase, membrane, repeat, rotamase, peptidylprolyl isomerase, structural genomics; 2.00A {Homo sapiens} Back     alignment and structure
>2a2n_A Peptidylprolyl isomerase domain and WD repeat CON; CIS-trans isomerization, protein-folding, peptidylprolyl ISO structural genomics; 1.65A {Homo sapiens} SCOP: b.62.1.1 Back     alignment and structure
>2k7n_A Peptidyl-prolyl CIS-trans isomerase-like 1; beta barrel, disorder-order transition, HOOK-like, mRNA processing, mRNA splicing, rotamase; NMR {Homo sapiens} Back     alignment and structure
>3k2c_A Peptidyl-prolyl CIS-trans isomerase; ssgcid, NIH, niaid, SBRI, UW, decode, cytoplasm, rotamase, structural genomics; HET: PG5; 1.95A {Encephalitozoon cuniculi} Back     alignment and structure
>2cmt_A Peptidyl-prolyl CIS-trans isomerase E; rotamase activity, rotamase, RNA-binding, cyclosporin, cyclophilin, beta-barrel; 1.50A {Schistosoma mansoni} PDB: 2ck1_A Back     alignment and structure
>4fru_A Cyclophilin B, peptidyl-prolyl CIS-trans isomerase; cyclophilin-type ppiase, peptidyl-prolyl CIS-trans isomerase chaperone, foldase; HET: ME2 PEG; 1.10A {Equus caballus} PDB: 4frv_A* 3ich_A 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>2z6w_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin D; HET: BMT MLE CIT; 0.96A {Homo sapiens} SCOP: b.62.1.1 PDB: 3rcg_A* 3r49_A* 3r54_A 3r56_A* 3r57_A* 3r59_A* 3rcf_A* 3r4g_A* 3rci_X* 3rck_X* 3rcl_A* 3rd9_X* 3rda_X* 3rdb_A* 3rdc_A* 2bit_X 2biu_X 3qyu_A 3k0m_A 1ak4_A* ... Back     alignment and structure
>3s6m_A Peptidyl-prolyl CIS-trans isomerase; seattle structural genomics center for infectious disease; 1.65A {Burkholderia pseudomallei} SCOP: b.62.1.1 PDB: 3t1u_A* Back     alignment and structure
>1v9t_A Cyclophilin B; beta barrel, isomerase-isomerase inhibitor complex; HET: NIT; 1.70A {Escherichia coli} SCOP: b.62.1.1 PDB: 1j2a_A* 1vai_A* 1clh_A Back     alignment and structure
>2r99_A Peptidyl-prolyl CIS-trans isomerase E; CIS-trans isomerization, structural genomics consortium, SGC, alternative splicing, mRNA processing; 1.61A {Homo sapiens} SCOP: b.62.1.1 PDB: 3uch_A 1zmf_A Back     alignment and structure
>3rdd_A Peptidyl-prolyl CIS-trans isomerase A; beta barrel, cytosolic, inhibito isomerase-isomerase inhibitor complex; HET: EA4; 2.14A {Homo sapiens} Back     alignment and structure
>1lop_A Cyclophilin A; rotamase, isomerase-isomerase inhibitor complex; HET: NIT; 1.80A {Escherichia coli} SCOP: b.62.1.1 PDB: 2nul_A 2rs4_A Back     alignment and structure
>3ich_A Peptidyl-prolyl CIS-trans isomerase B; beta sandwich, cyclosporin, endoplasmic reticulum, glycoprot isomerase, rotamase; 1.20A {Homo sapiens} PDB: 3ici_A* 1cyn_A* 2esl_A* 2rmc_A* 1h0p_A 1xo7_A 1xq7_A* Back     alignment and structure
>1qng_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, cyclophilin-cyclosporin complex, immunosuppressant, cyclophilin; HET: BMT; 2.1A {Plasmodium falciparum} SCOP: b.62.1.1 PDB: 1qnh_A* Back     alignment and structure
>2igv_A Peptidyl-prolyl CIS-trans isomerase 3; rotamase; 1.67A {Caenorhabditis elegans} SCOP: b.62.1.1 PDB: 1e3b_A 1e8k_A 1dyw_A 2igw_A 2hqj_A Back     alignment and structure
>2poy_A Peptidyl-prolyl CIS-trans isomerase; isomerase-immunosuppressant complex, immunosuppressant, cyclophilin, isomerase, S genomics, structural genomics consortium; HET: BMT; 1.80A {Cryptosporidium parvum iowa II} PDB: 2plu_A* Back     alignment and structure
>1z81_A Cyclophilin; structural genomics, structural genomics consortium, SGC, isomerase; 2.80A {Plasmodium yoelii yoelii} SCOP: b.62.1.1 Back     alignment and structure
>3rfy_A Peptidyl-prolyl CIS-trans isomerase CYP38, chloro; cyclophilin, peptidyl prolyl isomerase, ppiase, TLP,; 2.39A {Arabidopsis thaliana} Back     alignment and structure
>2ose_A Probable peptidyl-prolyl CIS-trans isomerase; cyclophilin; 2.04A {Mimivirus} Back     alignment and structure
>2c3b_A Ppiase, cyclophilin; isomerase, 3D domain swapping, misfolding, Asp F 11, allergen, rotamase; 1.85A {Aspergillus fumigatus} SCOP: b.62.1.1 Back     alignment and structure
>3bkp_A Cyclophilin; malaria, isomerase, structural GENO structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>2hq6_A Serologically defined colon cancer antigen 10; protein folding, peptidyl-prolyl CIS-trans isomerase, struct genomics; 1.75A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 232
d1xwna1166 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isome 2e-48
d1zkca1178 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans iso 1e-45
d2ok3a1159 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B 6e-42
d2cfea1162 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 7e-39
d2b71a1169 b.62.1.1 (A:23-191) Cyclophilin-like protein PY006 3e-38
d1a33a_174 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode ( 2e-35
d2fu0a1155 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w { 2e-35
d1qnga_170 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium 2e-34
d1w74a_171 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 3e-33
d1xo7a_166 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosom 6e-33
d2rmca_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus 9e-33
d2c3ba1171 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Asper 3e-32
d1h0pa_182 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabd 3e-32
d2igva1172 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caeno 9e-32
d1qoia_173 b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Hom 1e-30
d1ihga2195 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain 2e-30
d2a2na1164 b.62.1.1 (A:483-646) Peptidylprolyl isomerase doma 2e-29
d1lopa_164 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 1e-28
d2z6wa1164 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl c 1e-28
d1z81a1186 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plas 2e-27
d2r99a1161 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl 2e-26
d1v9ta_166 b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 4e-24
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Length = 166 Back     information, alignment and structure

class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  154 bits (391), Expect = 2e-48
 Identities = 67/137 (48%), Positives = 89/137 (64%)

Query: 57  THTGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSI 116
           T  G I +EL+ +  PKTC+NF  L    YYNG  FHR IK F++Q GDPT TG+GG SI
Sbjct: 18  TSMGIIVLELYWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI 77

Query: 117 WGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAHLDLKYTIFGKVIDGFE 176
           +GK+FEDE    LK +  GI++MAN GP+TN SQFF+T A    LD K+TIFG+V  G  
Sbjct: 78  YGKQFEDELHPDLKFTGAGILAMANAGPDTNGSQFFVTLAPTQWLDGKHTIFGRVCQGIG 137

Query: 177 TLDNLEKLPVNPNHKPI 193
            ++ +  +  N   +P+
Sbjct: 138 MVNRVGMVETNSQDRPV 154


>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Length = 159 Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Length = 162 Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Length = 169 Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Length = 174 Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Length = 155 Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Length = 170 Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Length = 171 Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Length = 166 Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Length = 182 Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Length = 171 Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Length = 182 Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Length = 172 Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Length = 173 Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Length = 195 Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 164 Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 164 Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Length = 186 Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Length = 161 Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query232
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 100.0
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 100.0
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 100.0
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 100.0
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 100.0
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 100.0
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 100.0
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 100.0
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 100.0
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 100.0
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 100.0
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 100.0
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 100.0
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 100.0
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 100.0
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 100.0
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 100.0
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 100.0
d2fu0a1155 Putative cyclophilin PFE0505w {Plasmodium falcipar 99.85
d2ok3a1159 Cyclophilin-like protein PPIL3B {Human (Homo sapie 99.84
d2r99a1161 Mitochondrial peptidyl-prolyl cis-trans isomerase, 99.83
d2b71a1169 Cyclophilin-like protein PY00693 {Plasmodium yoeli 99.83
d1zkca1178 Peptidyl-prolyl cis-trans isomerase-like 2, Cyclop 99.82
d1xwna1166 Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 99.82
d1h0pa_182 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 99.82
d1xo7a_166 Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId 99.81
d2rmca_182 Cyclophilin (eukaryotic) {Mouse (Mus musculus), va 99.81
d1qoia_173 Cyclophilin (eukaryotic) {Human (Homo sapiens), U4 99.81
d2a2na1164 Peptidylprolyl isomerase domain and WD repeat-cont 99.81
d2igva1172 Cyclophilin (eukaryotic) {Caenorhabditis elegans, 99.81
d2z6wa1164 Mitochondrial peptidyl-prolyl cis-trans isomerase, 99.81
d2cfea1162 Cyclophilin-like allergen Mal s 6 {Malassezia symp 99.8
d1v9ta_166 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.79
d1z81a1186 Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId 99.79
d1qnga_170 Cyclophilin (eukaryotic) {Plasmodium falciparum [T 99.79
d1lopa_164 Peptidyl-prolyl cis-trans isomerase A, PpiA {Esche 99.78
d2c3ba1171 Cyclophilin (eukaryotic) {Aspergillus fumigatus [T 99.74
d1ihga2195 Cyclophilin 40 isomerase domain {Cow (Bos taurus) 99.66
d1a33a_174 Cyclophilin (eukaryotic) {Nematode (Brugia malayi) 99.64
d1w74a_171 Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycob 99.58
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: Cyclophilin-like
superfamily: Cyclophilin-like
family: Cyclophilin (peptidylprolyl isomerase)
domain: Cyclophilin-like protein PPIL3B
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=7.8e-46  Score=285.24  Aligned_cols=158  Identities=72%  Similarity=1.182  Sum_probs=141.4

Q ss_pred             CEEEEEeCCeeEEEEeecCCCchhHHhHHHhhhcCcccceeeeeecceeEEeeCCCccccccceeccccCCCCcchhhhh
Q psy8249           1 MSVSLHTDVGDIKIELFCEDCPKTCENFLALCASDYYNGCIFHRNIKGFIVQTGDPTHTGDIKIELFCEDCPKTCENFLA   80 (232)
Q Consensus         1 ~~v~~~t~~G~i~i~L~~~~~p~~~~nf~~l~~~~~y~~~~f~rvi~~f~iq~Gd~t~~G~i~i~l~~~~~P~~~~~F~~   80 (232)
                      |||+|+|++|+|+|+||++.||+||+||++||+.++|+++.|||++++|++|+||+...+.-                  
T Consensus         1 msV~~~T~~G~i~ieL~~~~aP~tv~nF~~L~~~g~Y~~~~f~rv~~~~~iq~Gd~~~~~~~------------------   62 (159)
T d2ok3a1           1 MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRG------------------   62 (159)
T ss_dssp             CEEEEEETTEEEEEEECTTTCHHHHHHHHHHHHTTTTTTCBCCEEETTTEEEECCTTSSSSC------------------
T ss_pred             CEEEEEeCCeEEEEEEcCCCChHHHHHHHHHHhhhcccceeEecccCCeEEEeCCccccCCC------------------
Confidence            99999999999999999999999999999999999999999999999999999996532210                  


Q ss_pred             hccCCCCCCceeEEeecCcEEEcCCCCCCCCCCCccCCCCCcccccccccccccceEEecccCCCcccceEEeeccCCCC
Q psy8249          81 LCASDYYNGCIFHRNIKGFIVQTGDPTHTGKGGNSIWGKKFEDEFKETLKHSERGIVSMANNGPNTNASQFFITYAAHAH  160 (232)
Q Consensus        81 l~~~~~y~g~~~~rv~~~~~vq~G~~~~~~~~~~~~~~~~~~~e~~~~l~~~~~g~v~~~~~~~~~~~s~f~itl~~~~~  160 (232)
                                                      +...++..++.|..+.++|+++|+++|+++++++++|||||++++.|+
T Consensus        63 --------------------------------~~~~~~~~~~~e~~~~~~~~~~G~lsma~~~~~s~~sqFfIt~~~~p~  110 (159)
T d2ok3a1          63 --------------------------------GNSIWGKKFEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPH  110 (159)
T ss_dssp             --------------------------------CCCTTSSCBCCCCCTTCCSCSTTEEEECCSSTTCBCSCEEEESSCCGG
T ss_pred             --------------------------------CcccCCCccccccccCCCCCCCeEEEEeeCCCCCcCcceEeeeccCcc
Confidence                                            011234455666667788999999999999999999999999999999


Q ss_pred             CCCCccEEEEEeeccchhhhcccCCCCC-CCCceeeEEEeeeeecCCCC
Q psy8249         161 LDLKYTIFGKVIDGFETLDNLEKLPVNP-NHKPIFFITYAAHAHLDLKY  208 (232)
Q Consensus       161 ld~~~tvfG~VveG~dvl~~I~~~~~~~-~~~P~~~i~I~~~~~ld~~~  208 (232)
                      ||++|+|||+|++||++|++|+++++++ +++|..+|+|.+|.+|++||
T Consensus       111 ld~~~tvFG~V~~G~~vl~~I~~~~~~~~~~~P~~~i~I~~v~i~~~Pf  159 (159)
T d2ok3a1         111 LDMKYTVFGKVIDGLETLDELEKLPVNEKTYRPLNDVHIKDITIHANPF  159 (159)
T ss_dssp             GTTTSCEEEEEEECHHHHHHHHTCCBCTTTCCBSSCCBEEEEEEECCSC
T ss_pred             cccceEEEEecccchHHHHHHHcCcCCCCCCCcCCCcEEEEEEEEeCCC
Confidence            9999999999999999999999999876 57899999999999999986



>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d2fu0a1 b.62.1.1 (A:5-159) Putative cyclophilin PFE0505w {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2ok3a1 b.62.1.1 (A:1-159) Cyclophilin-like protein PPIL3B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2r99a1 b.62.1.1 (A:139-299) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b71a1 b.62.1.1 (A:23-191) Cyclophilin-like protein PY00693 {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwna1 b.62.1.1 (A:1-166) Peptidyl-prolyl cis-trans isomerase-like 1, PPIL1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h0pa_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 5 [TaxId: 6239]} Back     information, alignment and structure
>d1xo7a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2rmca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Mouse (Mus musculus), variant C [TaxId: 10090]} Back     information, alignment and structure
>d1qoia_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), U4/U6 snRNP-specific cyclophilin snucyp-20 [TaxId: 9606]} Back     information, alignment and structure
>d2a2na1 b.62.1.1 (A:483-646) Peptidylprolyl isomerase domain and WD repeat-containing protein 1, PPWD1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2igva1 b.62.1.1 (A:1-172) Cyclophilin (eukaryotic) {Caenorhabditis elegans, isoform 3 [TaxId: 6239]} Back     information, alignment and structure
>d2z6wa1 b.62.1.1 (A:2-165) Mitochondrial peptidyl-prolyl cis-trans isomerase, cyclophilin F {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cfea1 b.62.1.1 (A:1-162) Cyclophilin-like allergen Mal s 6 {Malassezia sympodialis [TaxId: 76777]} Back     information, alignment and structure
>d1v9ta_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z81a1 b.62.1.1 (A:25-210) Cyclophilin (eukaryotic) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1qnga_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1lopa_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c3ba1 b.62.1.1 (A:1-171) Cyclophilin (eukaryotic) {Aspergillus fumigatus [TaxId: 5085]} Back     information, alignment and structure
>d1ihga2 b.62.1.1 (A:2-196) Cyclophilin 40 isomerase domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a33a_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Nematode (Brugia malayi) [TaxId: 6279]} Back     information, alignment and structure
>d1w74a_ b.62.1.1 (A:) Peptidyl-prolyl cis-trans isomerase A, PpiA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure