Diaphorina citri psyllid: psy8252

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVNR
cccccHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHccccHHHHHHHHHcccccHHHHcccccccccccccccccccccccccHHHHHHHHccccccccccc
*AAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVNR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Nucleoside diphosphate kinase Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.confidentQ5GRR9
Nucleoside diphosphate kinase Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.confidentA5UDJ8
Nucleoside diphosphate kinase Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.confidentB4EZT7

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005488 [MF]bindingprobableGO:0003674
GO:0044267 [BP]cellular protein metabolic processprobableGO:0044238, GO:0044260, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:1901137 [BP]carbohydrate derivative biosynthetic processprobableGO:1901576, GO:1901135, GO:0071704, GO:0009058, GO:0008150, GO:0008152
GO:0004550 [MF]nucleoside diphosphate kinase activityprobableGO:0019205, GO:0016772, GO:0016301, GO:0016776, GO:0003824, GO:0016740, GO:0003674
GO:0009145 [BP]purine nucleoside triphosphate biosynthetic processprobableGO:0009141, GO:0009142, GO:0009144, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:1901362, GO:1901360, GO:0006139, GO:0044710, GO:0071704, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0008150, GO:0008152, GO:0034654, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:0044237, GO:0006796, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753
GO:0005856 [CC]cytoskeletonprobableGO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006165 [BP]nucleoside diphosphate phosphorylationprobableGO:0016310, GO:0044249, GO:0034641, GO:0009165, GO:0044281, GO:1901362, GO:1901360, GO:0006139, GO:0044710, GO:0046939, GO:0008150, GO:0071704, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:0009132, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:0044237, GO:0006796, GO:0006807, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753
GO:0006164 [BP]purine nucleotide biosynthetic processprobableGO:0044249, GO:0034641, GO:0009165, GO:0044281, GO:0072521, GO:0072522, GO:1901362, GO:1901360, GO:1901576, GO:0044710, GO:0008150, GO:0071704, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009117, GO:0008152, GO:0034654, GO:1901564, GO:0090407, GO:0055086, GO:0046483, GO:0044238, GO:0044271, GO:1901566, GO:0044237, GO:0006163, GO:0006796, GO:0006807, GO:1901293, GO:0006793, GO:0019637, GO:0019438, GO:0006753
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0007010 [BP]cytoskeleton organizationprobableGO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.4.-2,7,4'-trihydroxyisoflavanone 4'-O-methyltransferase.probable
2.7.4.6Nucleoside-diphosphate kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W7W, chain A
Confidence level:very confident
Coverage over the Query: 3-127
View the alignment between query and template
View the model in PyMOL