Psyllid ID: psy8252

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVNR
cccccHHHHHHHHHHcccccHHHHHccccHHHHHHHHHHccccccHHHHHHHHHccHHHHHHHccccHHHHHHHHHcccccHHHHcccccccccccccccccccccccccHHHHHHHHccccccccccc
ccEEEHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHccccccHHHHHHHccccEEEEEEccEEEEEcccccHcccccHHHcccccccEcccEEEEccccEEEccccHHHHHHHHHHHccHHHHcc
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARfshpysirgmygisdtrnaahgsewlrdynhepivhgrhtgvnr
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLrdynhepivhgrhtgvnr
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVNR
******KAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIV*********
*AAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVN*
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVNR
*AAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGVNR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
Q6DI51175 Nucleoside diphosphate ki yes N/A 0.798 0.588 0.477 2e-24
O75414186 Nucleoside diphosphate ki yes N/A 0.798 0.553 0.485 8e-22
O88425189 Nucleoside diphosphate ki yes N/A 0.798 0.544 0.475 4e-21
O88426175 Nucleoside diphosphate ki yes N/A 0.798 0.588 0.475 2e-20
B3DL53179 Nucleoside diphosphate ki yes N/A 0.798 0.575 0.456 2e-20
P56597212 Nucleoside diphosphate ki no N/A 0.798 0.485 0.436 4e-18
Q99MH5211 Nucleoside diphosphate ki no N/A 0.798 0.488 0.398 4e-17
Q1MPA2138 Nucleoside diphosphate ki yes N/A 0.767 0.717 0.431 3e-14
Q603C1143 Nucleoside diphosphate ki yes N/A 0.689 0.622 0.413 2e-13
Q9QXL7 395 Nucleoside diphosphate ki no N/A 0.775 0.253 0.346 7e-13
>sp|Q6DI51|NDK6_DANRE Nucleoside diphosphate kinase 6 OS=Danio rerio GN=nme6 PE=2 SV=1 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/109 (47%), Positives = 72/109 (66%), Gaps = 6/109 (5%)

Query: 1   MAAIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEI 60
           + A+H+K ++N I      I+        K  +E+FY+EH  +FF+ RLV  M SGP   
Sbjct: 25  LEALHQKILENFI------IIRKKDLIWRKADSEMFYAEHSGRFFFQRLVEFMSSGPMRA 78

Query: 61  NILARENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSE 109
            ILARE+AIT WR ++GPTKV+ ARFS P ++RG YG++DTRN  HGS+
Sbjct: 79  YILAREDAITHWRTMMGPTKVFRARFSSPETLRGKYGLTDTRNTTHGSD 127
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate.
Danio rerio (taxid: 7955)
EC: 2EC: .EC: 7EC: .EC: 4EC: .EC: 6
>sp|O75414|NDK6_HUMAN Nucleoside diphosphate kinase 6 OS=Homo sapiens GN=NME6 PE=1 SV=3 Back     alignment and function description
>sp|O88425|NDK6_MOUSE Nucleoside diphosphate kinase 6 OS=Mus musculus GN=Nme6 PE=2 SV=1 Back     alignment and function description
>sp|O88426|NDK6_RAT Nucleoside diphosphate kinase 6 (Fragment) OS=Rattus norvegicus GN=Nme6 PE=2 SV=1 Back     alignment and function description
>sp|B3DL53|NDK6_XENTR Nucleoside diphosphate kinase 6 OS=Xenopus tropicalis GN=nme6 PE=2 SV=1 Back     alignment and function description
>sp|P56597|NDK5_HUMAN Nucleoside diphosphate kinase homolog 5 OS=Homo sapiens GN=NME5 PE=2 SV=1 Back     alignment and function description
>sp|Q99MH5|NDK5_MOUSE Nucleoside diphosphate kinase homolog 5 OS=Mus musculus GN=Nme5 PE=2 SV=2 Back     alignment and function description
>sp|Q1MPA2|NDK_LAWIP Nucleoside diphosphate kinase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q603C1|NDK_METCA Nucleoside diphosphate kinase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=ndk PE=3 SV=1 Back     alignment and function description
>sp|Q9QXL7|NDK7_RAT Nucleoside diphosphate kinase 7 OS=Rattus norvegicus GN=Nme7 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
156548316185 PREDICTED: nucleoside diphosphate kinase 0.798 0.556 0.611 4e-31
307188616187 Nucleoside diphosphate kinase 6 [Campono 0.798 0.550 0.563 2e-30
110755579131 PREDICTED: nucleoside diphosphate kinase 0.821 0.809 0.584 3e-30
322791342160 hypothetical protein SINV_14934 [Solenop 0.837 0.675 0.546 5e-30
332024096176 Nucleoside diphosphate kinase 6 [Acromyr 0.953 0.698 0.487 6e-30
380013865187 PREDICTED: nucleoside diphosphate kinase 0.860 0.593 0.549 2e-29
383858077186 PREDICTED: nucleoside diphosphate kinase 0.798 0.553 0.572 3e-28
332375050173 unknown [Dendroctonus ponderosae] 0.798 0.595 0.582 4e-28
307193304 318 Nucleoside diphosphate kinase 6 [Harpegn 0.829 0.336 0.532 1e-27
350401444202 PREDICTED: nucleoside diphosphate kinase 0.798 0.509 0.563 2e-27
>gi|156548316|ref|XP_001602836.1| PREDICTED: nucleoside diphosphate kinase 6-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 63/103 (61%), Positives = 83/103 (80%)

Query: 7   KAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARE 66
           + I+++IL N F IV +  T +  ++ E FY EHK+KFFYNRL+T M SGPS+++ILA E
Sbjct: 26  QKIRDIILQNDFKIVRTRRTIIDIKEAEEFYKEHKEKFFYNRLLTFMCSGPSDVHILANE 85

Query: 67  NAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSE 109
           NAI KWR+LLGPTKV+ A++S P SIRGM+G+SDTRNAAHGS+
Sbjct: 86  NAIVKWRQLLGPTKVFQAQYSAPNSIRGMFGLSDTRNAAHGSD 128

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307188616|gb|EFN73333.1| Nucleoside diphosphate kinase 6 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|110755579|ref|XP_001119864.1| PREDICTED: nucleoside diphosphate kinase 6-like [Apis mellifera] Back     alignment and taxonomy information
>gi|322791342|gb|EFZ15832.1| hypothetical protein SINV_14934 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332024096|gb|EGI64313.1| Nucleoside diphosphate kinase 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|380013865|ref|XP_003690966.1| PREDICTED: nucleoside diphosphate kinase 6-like [Apis florea] Back     alignment and taxonomy information
>gi|383858077|ref|XP_003704529.1| PREDICTED: nucleoside diphosphate kinase 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332375050|gb|AEE62666.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|307193304|gb|EFN76171.1| Nucleoside diphosphate kinase 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350401444|ref|XP_003486154.1| PREDICTED: nucleoside diphosphate kinase 6-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
FB|FBgn0030573151 nmdyn-D6 "nmdyn-D6" [Drosophil 0.790 0.675 0.528 1.4e-23
UNIPROTKB|E1C720177 NME6 "Nucleoside diphosphate k 0.798 0.581 0.514 2.6e-22
UNIPROTKB|J9NSB4186 NME6 "Nucleoside diphosphate k 0.798 0.553 0.495 3.4e-22
UNIPROTKB|C9J9V6174 NME6 "Nucleoside diphosphate k 0.798 0.591 0.485 3.9e-21
UNIPROTKB|O75414186 NME6 "Nucleoside diphosphate k 0.798 0.553 0.485 3.9e-21
UNIPROTKB|F1SKM8186 NME6 "Nucleoside diphosphate k 0.798 0.553 0.485 4.9e-21
UNIPROTKB|F1MCI2186 NME6 "Nucleoside diphosphate k 0.798 0.553 0.475 8e-21
ZFIN|ZDB-GENE-000710-3175 nme6 "non-metastatic cells 6, 0.860 0.634 0.418 1.3e-20
MGI|MGI:1861676189 Nme6 "NME/NM23 nucleoside diph 0.798 0.544 0.475 2.1e-20
RGD|61896175 Nme6 "NME/NM23 nucleoside diph 0.798 0.588 0.475 7.2e-20
FB|FBgn0030573 nmdyn-D6 "nmdyn-D6" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 271 (100.5 bits), Expect = 1.4e-23, P = 1.4e-23
 Identities = 55/104 (52%), Positives = 71/104 (68%)

Query:     8 AIQNV--ILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILAR 65
             A+Q +  ++S  F I++     +TK+ +E FY+EHK KFFY+RL + M SGPS   IL  
Sbjct:    18 AMQQIRALISQNFTILDQKEVCITKELSERFYAEHKGKFFYHRLTSFMNSGPSYALILQS 77

Query:    66 ENAITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSE 109
             E  I KWR LLGPTKV+ A +S P  IR +YGISDTRNA HGS+
Sbjct:    78 ETCIQKWRSLLGPTKVFRAVYSDPNCIRALYGISDTRNACHGSD 121
GO:0004550 "nucleoside diphosphate kinase activity" evidence=ISS
GO:0005524 "ATP binding" evidence=IEA
GO:0006228 "UTP biosynthetic process" evidence=IEA
GO:0006241 "CTP biosynthetic process" evidence=IEA
GO:0006183 "GTP biosynthetic process" evidence=IEA
GO:0006165 "nucleoside diphosphate phosphorylation" evidence=IEA
UNIPROTKB|E1C720 NME6 "Nucleoside diphosphate kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSB4 NME6 "Nucleoside diphosphate kinase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9J9V6 NME6 "Nucleoside diphosphate kinase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75414 NME6 "Nucleoside diphosphate kinase 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SKM8 NME6 "Nucleoside diphosphate kinase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCI2 NME6 "Nucleoside diphosphate kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-000710-3 nme6 "non-metastatic cells 6, protein expressed in (nucleoside-diphosphate kinase)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1861676 Nme6 "NME/NM23 nucleoside diphosphate kinase 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|61896 Nme6 "NME/NM23 nucleoside diphosphate kinase 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5GRR9NDK_WOLTR2, ., 7, ., 4, ., 60.33940.82170.7625yesN/A
A5UDJ8NDK_HAEIE2, ., 7, ., 4, ., 60.35290.76740.7071yesN/A
B4EZT7NDK_PROMH2, ., 7, ., 4, ., 60.40190.76740.7021yesN/A
P43802NDK_HAEIN2, ., 7, ., 4, ., 60.35290.76740.7021yesN/A
B2I7V6NDK_XYLF22, ., 7, ., 4, ., 60.38540.72090.6595yesN/A
A5IC43NDK_LEGPC2, ., 7, ., 4, ., 60.370.75190.6879yesN/A
A4Y7C9NDK_SHEPC2, ., 7, ., 4, ., 60.37160.85270.7692yesN/A
C1DD40NDK_LARHH2, ., 7, ., 4, ., 60.37370.74410.6808yesN/A
Q4QM32NDK_HAEI82, ., 7, ., 4, ., 60.35290.76740.7021yesN/A
B6EGY3NDK_ALISL2, ., 7, ., 4, ., 60.37250.76740.6875yesN/A
Q87B35NDK_XYLFT2, ., 7, ., 4, ., 60.38540.72090.6595yesN/A
B0U495NDK_XYLFM2, ., 7, ., 4, ., 60.38540.72090.6595yesN/A
Q5WWH5NDK_LEGPL2, ., 7, ., 4, ., 60.370.75190.6879yesN/A
A7ZC05NDK_CAMC12, ., 7, ., 4, ., 60.36890.77510.7299yesN/A
A9L3Q1NDK_SHEB92, ., 7, ., 4, ., 60.38050.85270.7692yesN/A
A6WNX6NDK_SHEB82, ., 7, ., 4, ., 60.38050.85270.7692yesN/A
Q12LK6NDK_SHEDO2, ., 7, ., 4, ., 60.37160.85270.7692yesN/A
Q1MPA2NDK_LAWIP2, ., 7, ., 4, ., 60.43130.76740.7173yesN/A
A8HS90NDK_AZOC52, ., 7, ., 4, ., 60.36360.82940.7642yesN/A
Q89MS3NDK_BRAJA2, ., 7, ., 4, ., 60.38230.76740.7071yesN/A
B8EJZ0NDK_METSB2, ., 7, ., 4, ., 60.36270.76740.7071yesN/A
Q603C1NDK_METCA2, ., 7, ., 4, ., 60.41300.68990.6223yesN/A
Q7N710NDK_PHOLL2, ., 7, ., 4, ., 60.36890.77510.7092yesN/A
A5UI22NDK_HAEIG2, ., 7, ., 4, ., 60.35290.76740.7071yesN/A
Q5E776NDK_VIBF12, ., 7, ., 4, ., 60.38230.76740.6875yesN/A
A1RJ60NDK_SHESW2, ., 7, ., 4, ., 60.37160.85270.7692yesN/A
B4RVH4NDK_ALTMD2, ., 7, ., 4, ., 60.39210.76740.6923yesN/A
Q1H0U5NDK_METFK2, ., 7, ., 4, ., 60.3750.72090.6595yesN/A
Q0HVN6NDK_SHESR2, ., 7, ., 4, ., 60.38050.85270.7692yesN/A
Q0HJE6NDK_SHESM2, ., 7, ., 4, ., 60.38050.85270.7692yesN/A
B8E9E1NDK_SHEB22, ., 7, ., 4, ., 60.38050.85270.7692yesN/A
B5FAW8NDK_VIBFM2, ., 7, ., 4, ., 60.38230.76740.6875yesN/A
A3D569NDK_SHEB52, ., 7, ., 4, ., 60.38050.85270.7692yesN/A
Q8EEU0NDK_SHEON2, ., 7, ., 4, ., 60.38050.85270.7692yesN/A
A0KXI2NDK_SHESA2, ., 7, ., 4, ., 60.38050.85270.7692yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.7.40.766
4th Layer2.7.4.60.824

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
cd04414135 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (N 4e-45
cd04418132 cd04418, NDPk5, Nucleoside diphosphate kinase homo 2e-34
cd00595133 cd00595, NDPk, Nucleoside diphosphate kinases (NDP 5e-33
smart00562135 smart00562, NDK, Enzymes that catalyze nonsubstrat 4e-32
PLN02931177 PLN02931, PLN02931, nucleoside diphosphate kinase 2e-29
pfam00334135 pfam00334, NDK, Nucleoside diphosphate kinase 3e-29
cd04416132 cd04416, NDPk_TX, NDP kinase domain of thioredoxin 2e-26
cd04415131 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 d 2e-25
PRK00668134 PRK00668, ndk, mulitfunctional nucleoside diphosph 3e-21
cd04413130 cd04413, NDPk_I, Nucleoside diphosphate kinase Gro 4e-21
COG0105135 COG0105, Ndk, Nucleoside diphosphate kinase [Nucle 6e-18
cd04412134 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 d 1e-16
PRK14545139 PRK14545, PRK14545, nucleoside diphosphate kinase; 2e-14
PRK14540134 PRK14540, PRK14540, nucleoside diphosphate kinase; 1e-13
PRK14541140 PRK14541, PRK14541, nucleoside diphosphate kinase; 5e-12
PRK14542137 PRK14542, PRK14542, nucleoside diphosphate kinase; 5e-11
PTZ00093149 PTZ00093, PTZ00093, nucleoside diphosphate kinase, 1e-10
PLN02619238 PLN02619, PLN02619, nucleoside-diphosphate kinase 0.001
PRK14544183 PRK14544, PRK14544, nucleoside diphosphate kinase; 0.004
>gnl|CDD|239877 cd04414, NDPk6, Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information 
 Score =  142 bits (361), Expect = 4e-45
 Identities = 60/102 (58%), Positives = 73/102 (71%)

Query: 8   AIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILAREN 67
           A++ +ILSN F IV       T +  E FY+EHK KFFY+RLV+ M SGPS   ILA EN
Sbjct: 20  AVRQLILSNGFTIVRKKELRWTTEDAERFYAEHKGKFFYDRLVSFMTSGPSWALILAHEN 79

Query: 68  AITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSE 109
           AI  WR L+GPTKV+ AR S P SIRG+YG++DTRNA HGS+
Sbjct: 80  AIKTWRALMGPTKVFRARASAPDSIRGLYGLTDTRNATHGSD 121

NDPk6 has all nine residues considered crucial for enzyme structure and activity, and has been found to have NDP kinase activity. It may play a role in cell growth and cell cycle progression. The nm23-H6 gene locus has been implicated in a variety of malignant tumors. Length = 135
>gnl|CDD|239880 cd04418, NDPk5, Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>gnl|CDD|238335 cd00595, NDPk, Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>gnl|CDD|197791 smart00562, NDK, Enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>gnl|CDD|215503 PLN02931, PLN02931, nucleoside diphosphate kinase family protein Back     alignment and domain information
>gnl|CDD|201162 pfam00334, NDK, Nucleoside diphosphate kinase Back     alignment and domain information
>gnl|CDD|239879 cd04416, NDPk_TX, NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>gnl|CDD|239878 cd04415, NDPk7A, Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|179085 PRK00668, ndk, mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>gnl|CDD|239876 cd04413, NDPk_I, Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>gnl|CDD|223183 COG0105, Ndk, Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|239875 cd04412, NDPk7B, Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>gnl|CDD|184734 PRK14545, PRK14545, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184733 PRK14540, PRK14540, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173007 PRK14541, PRK14541, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173008 PRK14542, PRK14542, nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>gnl|CDD|173387 PTZ00093, PTZ00093, nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>gnl|CDD|178228 PLN02619, PLN02619, nucleoside-diphosphate kinase Back     alignment and domain information
>gnl|CDD|173010 PRK14544, PRK14544, nucleoside diphosphate kinase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
cd04415131 NDPk7A Nucleoside diphosphate kinase 7 domain A (N 100.0
COG0105135 Ndk Nucleoside diphosphate kinase [Nucleotide tran 100.0
PRK14542137 nucleoside diphosphate kinase; Provisional 100.0
PRK14541140 nucleoside diphosphate kinase; Provisional 100.0
cd04412134 NDPk7B Nucleoside diphosphate kinase 7 domain B (N 100.0
cd04414135 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 100.0
PRK14545139 nucleoside diphosphate kinase; Provisional 100.0
cd04418132 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP 100.0
PTZ00093149 nucleoside diphosphate kinase, cytosolic; Provisio 100.0
PRK14540134 nucleoside diphosphate kinase; Provisional 100.0
PLN02931177 nucleoside diphosphate kinase family protein 100.0
cd00595133 NDPk Nucleoside diphosphate kinases (NDP kinases, 100.0
cd04416132 NDPk_TX NDP kinase domain of thioredoxin domain-co 100.0
PRK00668134 ndk mulitfunctional nucleoside diphosphate kinase/ 100.0
cd04413130 NDPk_I Nucleoside diphosphate kinase Group I (NDPk 100.0
PLN02619238 nucleoside-diphosphate kinase 100.0
PRK14543169 nucleoside diphosphate kinase; Provisional 100.0
PF00334135 NDK: Nucleoside diphosphate kinase; InterPro: IPR0 100.0
KOG0888|consensus156 100.0
smart00562135 NDK These are enzymes that catalyze nonsubstrate s 100.0
PRK14544183 nucleoside diphosphate kinase; Provisional 100.0
TIGR0373866 PRTRC_C PRTRC system protein C. A novel genetic sy 81.6
>cd04415 NDPk7A Nucleoside diphosphate kinase 7 domain A (NDPk7A): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information 
Probab=100.00  E-value=2.2e-44  Score=251.07  Aligned_cols=118  Identities=39%  Similarity=0.594  Sum_probs=115.6

Q ss_pred             hHHHHHHHHHHhCCceEEceeeeccCHHHHHHHhHhhcCcccHHHHHhhhhcCcEEEEEEeeCcHHHHHHHHhCCCchhh
Q psy8252           4 IHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVYI   83 (129)
Q Consensus         4 ~~g~iI~~~i~~~gf~I~~~km~~ls~~~a~~~y~~~~~~~~~~~lv~~~~sGpvial~l~g~nav~~~r~l~Gp~~~~~   83 (129)
                      .+|+|| ++|+++||.|+++||++||+++|++||..|++++||++|+++|+|||+++|+|.|+|+|++||++|||++|..
T Consensus        14 ~~g~Il-~~i~~~Gf~I~~~k~~~lt~~~a~~~y~~~~gk~f~~~Lv~~m~sgp~va~~l~g~nav~~~R~l~Gpt~p~~   92 (131)
T cd04415          14 KIGKII-QIIEDAGFTITKAKMTKLSRKEAQDFYAEHQSKPFYNELVQFMTSGPIVAMELVGDDAISEWRKLLGPTNSSV   92 (131)
T ss_pred             hHHHHH-HHHHHCCCEEEEeeeecCCHHHHHHHHHHhCCCCchHHHHHHHhcCCeEEEEEECCcHHHHHHHHhCCCChHH
Confidence            378888 9999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhcCCCCcccccccCCCCcEEEeCCChhhhhHHhhhhh
Q psy8252          84 ARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHG  122 (129)
Q Consensus        84 a~~~~p~slR~~fg~~~~~N~vh~Sds~e~a~~e~~~f~  122 (129)
                      |+...|+|||+.||.+.++|+||||||+++|.+|+.+||
T Consensus        93 A~~~~p~siR~~fg~~~~~N~vH~Sds~e~a~~Ei~~fF  131 (131)
T cd04415          93 ARSDAPNSIRALFGTDGTRNAAHGSDSVASAARELEFFF  131 (131)
T ss_pred             hhccCCCcchhhhcccccceeEECCCCHHHHHHHHHhhC
Confidence            999999999999999999999999999999999999997

The function of the DM10 domain, which also occurs in multiple copies in other proteins, is unknown. NDPk7 is predominantly expressed in testes, although appreciable amount are also found in liver, heart, brain, ovary, small intestine and spleen. The nm23-H7 gene is located in or near the hereditary prostrate cancer susceptibility locus. Nm23-H7 may be involved in the development of colon and gastric carcinoma, the latter possibly in a type-specific manner.
>COG0105 Ndk Nucleoside diphosphate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14542 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PRK14541 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04412 NDPk7B Nucleoside diphosphate kinase 7 domain B (NDPk7B): The nm23-H7 class of nucleoside diphosphate kinase (NDPk7) consists of an N-terminal DM10 domain and two functional catalytic NDPk modules, NDPk7A and NDPk7B Back     alignment and domain information
>cd04414 NDPk6 Nucleoside diphosphate kinase 6 (NDP kinase 6, NDPk6, NM23-H6; NME6; Inhibitor of p53-induced apoptosis-alpha, IPIA-alpha): The nm23-H6 gene encoding NDPk6 is expressed mainly in mitochondria, but also found at a lower level in most tissues Back     alignment and domain information
>PRK14545 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>cd04418 NDPk5 Nucleoside diphosphate kinase homolog 5 (NDP kinase homolog 5, NDPk5, NM23-H5; Inhibitor of p53-induced apoptosis-beta, IPIA-beta): In human, mRNA for NDPk5 is almost exclusively found in testis, especially in the flagella of spermatids and spermatozoa, in association with axoneme microtubules, and may play a role in spermatogenesis by increasing the ability of late-stage spermatids to eliminate reactive oxygen species Back     alignment and domain information
>PTZ00093 nucleoside diphosphate kinase, cytosolic; Provisional Back     alignment and domain information
>PRK14540 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PLN02931 nucleoside diphosphate kinase family protein Back     alignment and domain information
>cd00595 NDPk Nucleoside diphosphate kinases (NDP kinases, NDPks): NDP kinases, responsible for the synthesis of nucleoside triphosphates (NTPs), are involved in numerous regulatory processes associated with proliferation, development, and differentiation Back     alignment and domain information
>cd04416 NDPk_TX NDP kinase domain of thioredoxin domain-containing proteins (TXNDC3 and TXNDC6): Txl-2 (TXNDC6) and Sptrx-2 (TXNDC3) are fusion proteins of Group II N-terminal thioredoxin domains followed by one or three NDP kinase domains, respectively Back     alignment and domain information
>PRK00668 ndk mulitfunctional nucleoside diphosphate kinase/apyrimidinic endonuclease/3'-; Validated Back     alignment and domain information
>cd04413 NDPk_I Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside triphosphate (NTP) donor onto a nucleoside diphosphate (NDP) acceptor through a phosphohistidine intermediate Back     alignment and domain information
>PLN02619 nucleoside-diphosphate kinase Back     alignment and domain information
>PRK14543 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>PF00334 NDK: Nucleoside diphosphate kinase; InterPro: IPR001564 Nucleoside diphosphate kinases (2 Back     alignment and domain information
>KOG0888|consensus Back     alignment and domain information
>smart00562 NDK These are enzymes that catalyze nonsubstrate specific conversions of nucleoside diphosphates to nucleoside triphosphates Back     alignment and domain information
>PRK14544 nucleoside diphosphate kinase; Provisional Back     alignment and domain information
>TIGR03738 PRTRC_C PRTRC system protein C Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
3pj9_A140 Crystal Structure Of A Nucleoside Diphosphate Kinas 2e-11
3vgu_A141 E134a Mutant Nucleoside Diphosphate Kinase Derived 7e-11
3vgs_A141 Wild-Type Nucleoside Diphosphate Kinase Derived Fro 7e-11
3ztq_A142 Hexagonal Crystal Form P61 Of The Aquifex Aeolicus 2e-10
2hur_A142 Escherichia Coli Nucleoside Diphosphate Kinase Leng 3e-10
4dut_A145 The Structure Of Nucleoside Diphosphate Kinase (Ndk 6e-09
1leo_A150 P100s Nucleoside Diphosphate Kinase Length = 150 3e-08
1hhq_A155 Role Of Active Site Resiude Lys16 In Nucleoside Dip 3e-08
1ndp_A155 Adenosine 5'-Diphosphate Binding And The Active Sit 3e-08
1npk_A154 Refined X-Ray Structure Of Dictyostelium Nucleoside 4e-08
2nck_R144 Crystal Structure Of Myxococcus Xanthus Nucleoside 5e-08
1lwx_A155 Azt Diphosphate Binding To Nucleoside Diphosphate K 2e-07
1b4s_A155 Structure Of Nucleoside Diphosphate Kinase H122g Mu 3e-07
1nsp_A155 Mechanism Of Phosphate Transfer By Nucleoside Dipho 3e-07
1ndk_A155 X-Ray Structure Of Nucleoside Diphosphate Kinase Le 3e-07
1hlw_A155 Structure Of The H122a Mutant Of The Nucleoside Dip 3e-07
1ncl_A150 Thermal Stability Of Hexameric And Tetrameric Nucle 5e-07
2vu5_A148 Crystal Structure Of Pndk From Bacillus Anthracis L 6e-07
1pae_X155 Nucleoside Diphosphate Kinase Length = 155 6e-07
2zua_A174 Crystal Structure Of Nucleoside Diphosphate Kinase 7e-07
3q83_A157 Crystal Structure Of Staphylococcus Aureus Nucleosi 7e-07
2az1_A181 Structure Of A Halophilic Nucleoside Diphosphate Ki 2e-06
2az3_A164 Structure Of A Halophilic Nucleoside Diphosphate Ki 2e-06
3b54_A161 Saccharomyces Cerevisiae Nucleoside Diphosphate Kin 2e-06
1wkj_A137 Crystal Structure Of Nucleoside Diphosphate Kinase 3e-06
1mn7_A155 Ndp Kinase Mutant (H122g;n119s;f64w) In Complex Wit 9e-06
3r9l_A155 Crystal Structure Of Nucleoside Diphosphate Kinase 2e-05
1w7w_A182 Structure And Mutational Analysis Of A Plant Mitoch 5e-05
1k44_A136 Mycobacterium Tuberculosis Nucleoside Diphosphate K 6e-05
1u8w_A149 Crystal Structure Of Arabidopsis Thaliana Nucleosid 6e-05
3ngr_A151 Crystal Structure Of Leishmania Nucleoside Diphosph 7e-05
1pku_A150 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-04
3mpd_A151 Crystal Structure Of Nucleoside Diphosphate Kinase 1e-04
1zs6_A169 Structure Of Human Nucleoside-diphosphate Kinase 3 2e-04
1ndl_A153 The Awd Nucleotide Diphosphate Kinase From Drosophi 3e-04
1nsk_R152 The Crystal Structure Of A Human Nucleoside Diphosp 4e-04
1nue_A151 X-ray Structure Of Nm23 Human Nucleoside Diphosphat 4e-04
3l7u_A172 Crystal Structure Of Human Nm23-H1 Length = 172 4e-04
1jxv_A152 Crystal Structure Of Human Nucleoside Diphosphate K 4e-04
1bhn_A152 Nucleoside Diphosphate Kinase Isoform A From Bovine 7e-04
1be4_A151 Nucleoside Diphosphate Kinase Isoform B From Bovine 8e-04
>pdb|3PJ9|A Chain A, Crystal Structure Of A Nucleoside Diphosphate Kinase From Campylobacter Jejuni Length = 140 Back     alignment and structure 
Iteration: 1

 Score = 63.9 bits (154), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 38/103 (36%), Positives = 55/103 (53%), Gaps = 3/103 (2%)
Query: 15  SNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRE 74
           SN   I       ++K+Q E FY+ HK++ F+  LV  MISGP  ++IL  E A+ K R+
Sbjct: 30  SNGLRIAAMKKVQLSKEQAENFYAVHKERPFFKDLVEFMISGPVVVSILEGEGAVLKNRD 89
Query: 75  LLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHE 117
           L+G T    A+     +IR  +  S   NA HGS+ L +   E
Sbjct: 90  LMGATNPKEAKAG---TIRADFAESIDANAVHGSDSLENAKIE 129
>pdb|3VGU|A Chain A, E134a Mutant Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3VGS|A Chain A, Wild-Type Nucleoside Diphosphate Kinase Derived From Halomonas Sp. 593 Length = 141 Back     alignment and structure
>pdb|3ZTQ|A Chain A, Hexagonal Crystal Form P61 Of The Aquifex Aeolicus Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|2HUR|A Chain A, Escherichia Coli Nucleoside Diphosphate Kinase Length = 142 Back     alignment and structure
>pdb|4DUT|A Chain A, The Structure Of Nucleoside Diphosphate Kinase (Ndk) From Burkholderia Thailandensis Length = 145 Back     alignment and structure
>pdb|1LEO|A Chain A, P100s Nucleoside Diphosphate Kinase Length = 150 Back     alignment and structure
>pdb|1HHQ|A Chain A, Role Of Active Site Resiude Lys16 In Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NDP|A Chain A, Adenosine 5'-Diphosphate Binding And The Active Site Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NPK|A Chain A, Refined X-Ray Structure Of Dictyostelium Nucleoside Diphosphate Kinase At 1,8 Angstroms Resolution Length = 154 Back     alignment and structure
>pdb|2NCK|R Chain R, Crystal Structure Of Myxococcus Xanthus Nucleoside Diphosphate Kinase And Its Interaction With A Nucleotide Substrate At 2.0 Angstroms Resolution Length = 144 Back     alignment and structure
>pdb|1LWX|A Chain A, Azt Diphosphate Binding To Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1B4S|A Chain A, Structure Of Nucleoside Diphosphate Kinase H122g Mutant Length = 155 Back     alignment and structure
>pdb|1NSP|A Chain A, Mechanism Of Phosphate Transfer By Nucleoside Diphosphate Kinase: X- Ray Structures Of A Phospho-Histidine Intermediate Of The Enzymes From Drosophila And Dictyostelium Length = 155 Back     alignment and structure
>pdb|1NDK|A Chain A, X-Ray Structure Of Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1HLW|A Chain A, Structure Of The H122a Mutant Of The Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|1NCL|A Chain A, Thermal Stability Of Hexameric And Tetrameric Nucleoside, Diphosphate Kinases Length = 150 Back     alignment and structure
>pdb|2VU5|A Chain A, Crystal Structure Of Pndk From Bacillus Anthracis Length = 148 Back     alignment and structure
>pdb|1PAE|X Chain X, Nucleoside Diphosphate Kinase Length = 155 Back     alignment and structure
>pdb|2ZUA|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Haloarcula Quadrata Length = 174 Back     alignment and structure
>pdb|3Q83|A Chain A, Crystal Structure Of Staphylococcus Aureus Nucleoside Diphosphate Kinase Length = 157 Back     alignment and structure
>pdb|2AZ1|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum Length = 181 Back     alignment and structure
>pdb|2AZ3|A Chain A, Structure Of A Halophilic Nucleoside Diphosphate Kinase From Halobacterium Salinarum In Complex With Cdp Length = 164 Back     alignment and structure
>pdb|3B54|A Chain A, Saccharomyces Cerevisiae Nucleoside Diphosphate Kinase Length = 161 Back     alignment and structure
>pdb|1WKJ|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Thermus Thermophilus Hb8 Length = 137 Back     alignment and structure
>pdb|1MN7|A Chain A, Ndp Kinase Mutant (H122g;n119s;f64w) In Complex With Abazttp Length = 155 Back     alignment and structure
>pdb|3R9L|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Giardia Lamblia Featuring A Disordered Dinucleotide Binding Site Length = 155 Back     alignment and structure
>pdb|1W7W|A Chain A, Structure And Mutational Analysis Of A Plant Mitochondrial Nucleoside Diphosphate Kinase: Identification Of Residues Involved In Serine Phosphorylation And Oligomerization. Length = 182 Back     alignment and structure
>pdb|1K44|A Chain A, Mycobacterium Tuberculosis Nucleoside Diphosphate Kinase Length = 136 Back     alignment and structure
>pdb|1U8W|A Chain A, Crystal Structure Of Arabidopsis Thaliana Nucleoside Diphosphate Kinase 1 Length = 149 Back     alignment and structure
>pdb|3NGR|A Chain A, Crystal Structure Of Leishmania Nucleoside Diphosphate Kinase B With Unordered Nucleotide-Binding Loop. Length = 151 Back     alignment and structure
>pdb|1PKU|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Rice Length = 150 Back     alignment and structure
>pdb|3MPD|A Chain A, Crystal Structure Of Nucleoside Diphosphate Kinase From Encephalitozoon Cuniculi, Cubic Form, Apo Length = 151 Back     alignment and structure
>pdb|1ZS6|A Chain A, Structure Of Human Nucleoside-diphosphate Kinase 3 Length = 169 Back     alignment and structure
>pdb|1NDL|A Chain A, The Awd Nucleotide Diphosphate Kinase From Drosophila Length = 153 Back     alignment and structure
>pdb|1NSK|R Chain R, The Crystal Structure Of A Human Nucleoside Diphosphate Kinase, Nm23-H2 Length = 152 Back     alignment and structure
>pdb|1NUE|A Chain A, X-ray Structure Of Nm23 Human Nucleoside Diphosphate Kinase B Complexed With Gdp At 2 Angstroms Resolution Length = 151 Back     alignment and structure
>pdb|3L7U|A Chain A, Crystal Structure Of Human Nm23-H1 Length = 172 Back     alignment and structure
>pdb|1JXV|A Chain A, Crystal Structure Of Human Nucleoside Diphosphate Kinase A Length = 152 Back     alignment and structure
>pdb|1BHN|A Chain A, Nucleoside Diphosphate Kinase Isoform A From Bovine Retina Length = 152 Back     alignment and structure
>pdb|1BE4|A Chain A, Nucleoside Diphosphate Kinase Isoform B From Bovine Retina Length = 151 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 2e-24
4ek2_A145 Nucleoside diphosphate kinase; seattle structural 4e-22
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 2e-21
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 4e-21
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 8e-21
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 2e-20
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 3e-20
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 4e-20
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 6e-20
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 1e-19
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 1e-19
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 1e-19
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 1e-19
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 1e-19
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 1e-19
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 2e-19
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 2e-19
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 2e-19
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 2e-19
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 3e-19
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 3e-19
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 3e-19
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 5e-19
3js9_A156 Nucleoside diphosphate kinase family protein; niai 5e-19
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 7e-19
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 8e-19
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 3e-18
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 5e-14
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 1e-10
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Length = 142 Back     alignment and structure
 Score = 89.9 bits (224), Expect = 2e-24
 Identities = 34/100 (34%), Positives = 49/100 (49%)

Query: 9   IQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENA 68
           I +  +   F I        T ++   FY  H+++ F+  LV  M SGP    +L  E+A
Sbjct: 23  ILDRFIQEGFQIKALKMFRFTPEKAGEFYYVHRERPFFQELVEFMSSGPVVAAVLEGEDA 82

Query: 69  ITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGS 108
           I + RE++GPT    AR   P SIR  +G    +NA H S
Sbjct: 83  IKRVREIIGPTDSEEARKVAPNSIRAQFGTDKGKNAIHAS 122
>4ek2_A Nucleoside diphosphate kinase; seattle structural genomics center for infectious disease, S DAMP, niaid; HET: DA; 2.00A {Burkholderia thailandensis} PDB: 4dut_A* Length = 145 Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Length = 142 Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Length = 144 Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Length = 136 Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Length = 146 Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Length = 137 Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} Length = 151 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Length = 151 Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Length = 161 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Length = 153 Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} Length = 155 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Length = 182 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Length = 150 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Length = 149 Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Length = 162 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Length = 164 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Length = 155 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Length = 169 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Length = 148 Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Length = 157 Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Length = 157 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} Length = 156 Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Length = 161 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Length = 172 Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Length = 160 Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Length = 190 Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Length = 195 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
3ztp_A142 Nucleoside diphosphate kinase; transferase; HET: G 100.0
4hr2_A145 Nucleoside diphosphate kinase; ssgcid, seattle str 100.0
3evo_A146 NDP kinase, NDK, nucleoside diphosphate kinase; ph 100.0
4fkx_A161 NDK B, nucleoside diphosphate kinase; structural g 100.0
3mpd_A151 Nucleoside diphosphate kinase; ssgcid, NIH, niaid, 100.0
3fkb_A155 NDP kinase, NDK, nucleoside diphosphate kinase, cy 100.0
1wkj_A137 Nucleoside diphosphate kinase; thermus thermophilu 100.0
1nhk_R144 Nucleoside diphosphate kinase; phosphotransferase; 100.0
3q8u_A157 Nucleoside diphosphate kinase; ferridoxin fold, al 100.0
2hur_A142 NDK, nucleoside diphosphate kinase, NDP kinase; ty 100.0
1k44_A136 Nucleoside diphosphate kinase; nucleoside triphosp 100.0
2vu5_A148 Nucleoside diphosphate kinase; nucleotide-binding, 100.0
1ehw_A162 NDPK H4, nucleoside diphosphate kinase; NM23, mito 100.0
3js9_A156 Nucleoside diphosphate kinase family protein; niai 100.0
1pku_A150 Nucleoside diphosphate kinase I; RICE, transferase 100.0
3l7u_A172 Nucleoside diphosphate kinase A; ATP-binding, nucl 100.0
1xiq_A157 Nucleoside diphosphate kinase B; protein structure 100.0
3bbb_A151 Nucleoside diphosphate kinase B; transcription fac 100.0
3r9l_A155 Nucleoside diphosphate kinase; structural genomics 100.0
1u8w_A149 Nucleoside diphosphate kinase I; nucleotide diphos 100.0
1nb2_A150 Nucleoside diphosphate kinase; bacillus halodenitr 100.0
1s57_A153 Nucleoside diphosphate kinase II; transferase; HET 100.0
2dxe_A160 Nucleoside diphosphate kinase; nucleoside binding, 100.0
3b54_A161 NDK, NDP kinase, nucleoside diphosphate kinase; al 100.0
1w7w_A182 Nucleoside diphosphate kinase; NDPK3, transferase; 100.0
1zs6_A169 Nucleoside diphosphate kinase 3; nucleotide metabo 100.0
2az3_A164 Nucleoside diphosphate kinase; halophilic, transfe 100.0
4dz6_A190 Nucleoside diphosphate kinase; ssgcid, niaid, vana 100.0
1xqi_A195 Nucleoside diphosphate kinase; alpha/beta sandwich 100.0
3bh7_B352 Protein XRP2; protein-protein complex, GTPase acti 99.96
>3ztp_A Nucleoside diphosphate kinase; transferase; HET: GOL; 1.37A {Aquifex aeolicus} PDB: 3zto_A* 3ztq_A 3ztr_A 3zts_A Back     alignment and structure
Probab=100.00  E-value=2.1e-47  Score=268.28  Aligned_cols=124  Identities=28%  Similarity=0.386  Sum_probs=120.2

Q ss_pred             hhHHHHHHHHHHhCCceEEceeeeccCHHHHHHHhHhhcCcccHHHHHhhhhcCcEEEEEEeeCcHHHHHHHHhCCCchh
Q psy8252           3 AIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVY   82 (129)
Q Consensus         3 ~~~g~iI~~~i~~~gf~I~~~km~~ls~~~a~~~y~~~~~~~~~~~lv~~~~sGpvial~l~g~nav~~~r~l~Gp~~~~   82 (129)
                      +++|+|| ++|+++||+|+++||++||+++|++||.+|+++|||++|++||+|||+++|+|+|+|||++||+++|||+|.
T Consensus        18 ~~~g~Ii-~~i~~~Gf~I~~~k~~~ls~e~a~~~Y~~~~~kpff~~Lv~~mtSGPvva~vl~g~naV~~~R~l~G~t~p~   96 (142)
T 3ztp_A           18 GALGKIL-DRFIQEGFQIKALKMFRFTPEKAGEFYYVHRERPFFQELVEFMSSGPVVAAVLEGEDAIKRVREIIGPTDSE   96 (142)
T ss_dssp             TCHHHHH-HHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEEEETHHHHHHHHHCCSSHH
T ss_pred             ccHHHHH-HHHHHcCCEEEEEeeccCCHHHHHHHHHHhcCCchHHHHHHHhcCCCEEEEEEeCCCHHHHHHHhcCCCCHH
Confidence            4679998 999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcCCCCcccccccCCCCcEEEeCCChhhhhHHhhhhhccccc
Q psy8252          83 IARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGV  127 (129)
Q Consensus        83 ~a~~~~p~slR~~fg~~~~~N~vh~Sds~e~a~~e~~~f~~~~~~  127 (129)
                      .|+...|+|||++||.+..+|+||||||+++|.+||.+||...++
T Consensus        97 ~A~~~~pgtiR~~fg~~~~~N~vHgSDs~esA~rEi~~fF~~~e~  141 (142)
T 3ztp_A           97 EARKVAPNSIRAQFGTDKGKNAIHASDSPESAQYEICFIFSGLEI  141 (142)
T ss_dssp             HHHHHCTTSHHHHHCCSSSSCSEEECCSHHHHHHHHHHHCCGGGC
T ss_pred             HhhhcCCCChHHHhCCCCCceeEEeCCCHHHHHHHHHHcCCcccc
Confidence            999999999999999999999999999999999999999987654
>4hr2_A Nucleoside diphosphate kinase; ssgcid, seattle structural genomics center for infectious DI niaid; HET: ADP; 1.95A {Burkholderia thailandensis} PDB: 4dut_A* 4ek2_A* Back     alignment and structure
>3evo_A NDP kinase, NDK, nucleoside diphosphate kinase; phosphotransferase nucleotide binding, ATP-binding, magnesium, metal-binding; HET: TYD; 1.50A {Acanthamoeba polyphaga mimivirus} SCOP: d.58.6.1 PDB: 3ejm_A* 3emt_A* 3em1_A* 3fc9_A* 3g2x_A* 3ena_A* 3dkd_A* 3ddi_A* 3etm_A* 3evm_A* 3fcv_A* 3b6b_A* 2b8p_A* 3gp9_A* 2b8q_A* 3ee3_A* 3elh_A* 3eic_A* 3evw_A* 3gpa_A* ... Back     alignment and structure
>4fkx_A NDK B, nucleoside diphosphate kinase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CDP; 1.70A {Trypanosoma brucei brucei} PDB: 4fky_A* 4f4a_A* 4f36_A* 3prv_A 3ngs_A 3ngr_A 3ngt_A* 3ngu_A* Back     alignment and structure
>3mpd_A Nucleoside diphosphate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, encepha cuniculi, structural genomics; 2.08A {Encephalitozoon cuniculi} SCOP: d.58.6.0 Back     alignment and structure
>3fkb_A NDP kinase, NDK, nucleoside diphosphate kinase, cytosolic; AN hexamer structure, ATP-binding, magnesium, metal- nucleotide metabolism; HET: TNM TNV; 1.65A {Dictyostelium discoideum} SCOP: d.58.6.1 PDB: 1b4s_A* 1mn9_A* 1f3f_A* 1hlw_A 1ndk_A 1pae_X 1f6t_A* 1bux_A* 1b99_A* 1hiy_A* 1kdn_A* 1ndc_A* 1ndp_A* 1nsp_A* 1s5z_A* 2bef_A* 1mn7_A* 1hhq_A 1lwx_A* 1npk_A ... Back     alignment and structure
>1wkj_A Nucleoside diphosphate kinase; thermus thermophilus HB8, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.00A {Thermus thermophilus} SCOP: d.58.6.1 PDB: 1wkk_A* 1wkl_A* Back     alignment and structure
>1nhk_R Nucleoside diphosphate kinase; phosphotransferase; HET: CMP; 1.90A {Myxococcus xanthus} SCOP: d.58.6.1 PDB: 1nlk_R* 2nck_R 3pj9_A Back     alignment and structure
>3q8u_A Nucleoside diphosphate kinase; ferridoxin fold, alpha-beta protein family; HET: ADP; 2.22A {Staphylococcus aureus subsp} PDB: 3q83_A* 3q89_A* 3q86_A* 3q8v_A* 3q8y_A* Back     alignment and structure
>2hur_A NDK, nucleoside diphosphate kinase, NDP kinase; type II tetramer, signaling protein,transferase; 1.62A {Escherichia coli} Back     alignment and structure
>1k44_A Nucleoside diphosphate kinase; nucleoside triphosphate, transferase; 2.60A {Mycobacterium tuberculosis} SCOP: d.58.6.1 Back     alignment and structure
>2vu5_A Nucleoside diphosphate kinase; nucleotide-binding, ATP-binding, metal-binding, phosphoprotein, nucleotide metabolism, cytoplasm, magnesium; 2.0A {Bacillus anthracis} Back     alignment and structure
>1ehw_A NDPK H4, nucleoside diphosphate kinase; NM23, mitochondrial, killer-O transferase; 2.40A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>3js9_A Nucleoside diphosphate kinase family protein; niaid, ssgcid, seattle structural genomics center for infect disease, babesiosis; 2.50A {Babesia bovis} SCOP: d.58.6.0 Back     alignment and structure
>1pku_A Nucleoside diphosphate kinase I; RICE, transferase; 2.50A {Oryza sativa} SCOP: d.58.6.1 Back     alignment and structure
>3l7u_A Nucleoside diphosphate kinase A; ATP-binding, nucleotide-binding, transferase, tumor suppressor; 2.10A {Homo sapiens} Back     alignment and structure
>1xiq_A Nucleoside diphosphate kinase B; protein structure initiative, structural genomics, SGPP; 3.05A {Plasmodium falciparum} SCOP: d.58.6.1 Back     alignment and structure
>3bbb_A Nucleoside diphosphate kinase B; transcription factor, cancer, NM23 GEN, hexamer, activator, oncogene, ATP-binding, cell cycle, DNA-binding; HET: DG DA; 1.30A {Homo sapiens} SCOP: d.58.6.1 PDB: 1nue_A* 3bbf_A* 1nsk_R 3bbc_A 1be4_A* 1bhn_A* 2hvd_A* 1jxv_A* 2hve_A* 1ucn_A* 1nsq_A* 1ndl_A* Back     alignment and structure
>3r9l_A Nucleoside diphosphate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, giardiasis; 2.65A {Giardia lamblia} SCOP: d.58.6.1 Back     alignment and structure
>1u8w_A Nucleoside diphosphate kinase I; nucleotide diphosphate, transferase; 2.40A {Arabidopsis thaliana} SCOP: d.58.6.1 Back     alignment and structure
>1nb2_A Nucleoside diphosphate kinase; bacillus halodenitrifians, transferase; 2.20A {Virgibacillus halodenitrificans} SCOP: d.58.6.1 Back     alignment and structure
>1s57_A Nucleoside diphosphate kinase II; transferase; HET: EPE; 1.80A {Arabidopsis thaliana} SCOP: d.58.6.1 PDB: 1s59_A* Back     alignment and structure
>2dxe_A Nucleoside diphosphate kinase; nucleoside binding, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: d.58.6.1 PDB: 2dxd_A* 2cwk_A* 2dxf_A* 2dy9_A* 2dya_A* Back     alignment and structure
>3b54_A NDK, NDP kinase, nucleoside diphosphate kinase; alpha/beta sandwich, ATP-binding, magnesium, metal-B mitochondrion; 3.10A {Saccharomyces cerevisiae} Back     alignment and structure
>1w7w_A Nucleoside diphosphate kinase; NDPK3, transferase; 2.80A {Pisum sativum} SCOP: d.58.6.1 Back     alignment and structure
>1zs6_A Nucleoside diphosphate kinase 3; nucleotide metabolism, apoptosis, transferase, struc genomics, structural genomics consortium, SGC; HET: ADP; 2.30A {Homo sapiens} SCOP: d.58.6.1 Back     alignment and structure
>2az3_A Nucleoside diphosphate kinase; halophilic, transferase; HET: CDP; 2.20A {Halobacterium salinarum} SCOP: d.58.6.1 PDB: 2az1_A 2zua_A Back     alignment and structure
>4dz6_A Nucleoside diphosphate kinase; ssgcid, niaid, vanada transition state mimic, transition state analog, transferas; HET: ADP; 2.20A {Borrelia burgdorferi} PDB: 4di6_A* Back     alignment and structure
>1xqi_A Nucleoside diphosphate kinase; alpha/beta sandwich, ferredoxin fold, transferase; HET: PGE; 2.50A {Pyrobaculum aerophilum} SCOP: d.58.6.1 Back     alignment and structure
>3bh7_B Protein XRP2; protein-protein complex, GTPase activating protein and GTPase, retinitis pigmentosa, GTP-binding, lipoprotein, myristate; HET: GDP; 1.90A {Homo sapiens} PDB: 3bh6_B* 2bx6_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d3bbba1150 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, 7e-18
d1xqia1182 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, 8e-18
d1k44a_135 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 8e-17
d1zs6a1152 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, 1e-16
d1wkja1137 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, 2e-16
d2az3a1152 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, 9e-16
d1w7wa_151 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 8e-15
d1ehwa_143 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 1e-14
d1nhkl_143 d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK { 1e-14
d2b8qa1128 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, 8e-14
d1xiqa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-13
d1u8wa_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-13
d1hlwa_150 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 4e-13
d1nb2a_149 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 6e-13
d1s57a_153 d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK { 2e-12
d2dyaa1153 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, 1e-11
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 72.3 bits (177), Expect = 7e-18
 Identities = 28/101 (27%), Positives = 44/101 (43%), Gaps = 3/101 (2%)

Query: 9   IQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENA 68
           I        F +V       +++  +  Y + KD+ F+  LV  M SGP    +    N 
Sbjct: 23  IIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNV 82

Query: 69  ITKWRELLGPTKVYIARFSHPYSIRGMYGISDTRNAAHGSE 109
           +   R +LG T    ++   P +IRG + I   RN  HGS+
Sbjct: 83  VKTGRVMLGETNPADSK---PGTIRGDFCIQVGRNIIHGSD 120
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 182 Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Length = 135 Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Length = 152 Back     information, alignment and structure
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Length = 137 Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Length = 152 Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Length = 151 Back     information, alignment and structure
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Length = 143 Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Length = 143 Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Length = 128 Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Length = 149 Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 149 Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Length = 150 Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Length = 149 Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Length = 153 Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1ehwa_143 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1wkja1137 Nucleoside diphosphate kinase, NDK {Thermus thermo 100.0
d1nhkl_143 Nucleoside diphosphate kinase, NDK {Myxococcus xan 100.0
d3bbba1150 Nucleoside diphosphate kinase, NDK {Human (Homo sa 100.0
d1w7wa_151 Nucleoside diphosphate kinase, NDK {Pea (Pisum sat 100.0
d1zs6a1152 Nucleoside diphosphate kinase, NDK {Human(Homo sap 100.0
d1nb2a_149 Nucleoside diphosphate kinase, NDK {Bacillus halod 100.0
d1k44a_135 Nucleoside diphosphate kinase, NDK {Mycobacterium 100.0
d1xiqa_149 Nucleoside diphosphate kinase, NDK {Plasmodium fal 100.0
d1hlwa_150 Nucleoside diphosphate kinase, NDK {Dictyostelium 100.0
d1u8wa_149 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d1s57a_153 Nucleoside diphosphate kinase, NDK {Thale cress (A 100.0
d2az3a1152 Nucleoside diphosphate kinase, NDK {Archaeon Halob 100.0
d2dyaa1153 Nucleoside diphosphate kinase, NDK {Archaeon Pyroc 100.0
d1xqia1182 Nucleoside diphosphate kinase, NDK {Archaeon Pyrob 100.0
d2b8qa1128 Nucleoside diphosphate kinase, NDK {Mimivirus [Tax 100.0
>d1ehwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens), NDK4 [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: Nucleoside diphosphate kinase, NDK
family: Nucleoside diphosphate kinase, NDK
domain: Nucleoside diphosphate kinase, NDK
species: Human (Homo sapiens), NDK4 [TaxId: 9606]

Probab=100.00  E-value=2.3e-45  Score=256.53  Aligned_cols=121  Identities=21%  Similarity=0.276  Sum_probs=117.2

Q ss_pred             hhHHHHHHHHHHhCCceEEceeeeccCHHHHHHHhHhhcCcccHHHHHhhhhcCcEEEEEEeeCcHHHHHHHHhCCCchh
Q psy8252           3 AIHEKAIQNVILSNQFHIVESLTTAMTKQQTEIFYSEHKDKFFYNRLVTQMISGPSEINILARENAITKWRELLGPTKVY   82 (129)
Q Consensus         3 ~~~g~iI~~~i~~~gf~I~~~km~~ls~~~a~~~y~~~~~~~~~~~lv~~~~sGpvial~l~g~nav~~~r~l~Gp~~~~   82 (129)
                      +++|+|| ++|+++||+|+++|+++||+++|++||..|++++||++|+++|+||||++|+|+|+|||++||+++||++|.
T Consensus        20 ~~~g~Ii-~~i~~~Gf~Iv~~k~~~lt~e~a~~~Y~~~~~k~f~~~lv~~m~sGp~~a~~l~g~naV~~~R~l~Gpt~p~   98 (143)
T d1ehwa_          20 RLVGDVI-QRFERRGFTLVGMKMLQAPESVLAEHYQDLRRKPFYPALIRYMSSGPVVAMVWEGYNVVRASRAMIGHTDSA   98 (143)
T ss_dssp             TCHHHHH-HHHHHTTCEEEEEEEECCCHHHHHHHTGGGTTSTTHHHHHHHHTSSCEEEEEEESTTHHHHHHHHHCCSSGG
T ss_pred             CCHHHHH-HHHHHcCCEEeeeeeeecCHHHHHHHHHHHhcchhhhhhhheecCCCEEEEecchhhHHHHHHHHhcCCCcc
Confidence            4578888 999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcCCCCcccccccCCCCcEEEeCCChhhhhHHhhhhhccccc
Q psy8252          83 IARFSHPYSIRGMYGISDTRNAAHGSEWLRDYNHEPIVHGRHTGV  127 (129)
Q Consensus        83 ~a~~~~p~slR~~fg~~~~~N~vh~Sds~e~a~~e~~~f~~~~~~  127 (129)
                      +|   +|+|||++||++..+|++|||||+++|.+|+.+||...++
T Consensus        99 ~a---~p~siR~~yg~~~~~N~vH~Sds~e~A~~Ei~~fF~~~ei  140 (143)
T d1ehwa_          99 EA---APGTIRGDFSVHISRNVIHASDSVEGAQREIQLWFQSSEL  140 (143)
T ss_dssp             GS---CTTSHHHHHCCCSSCCSEEECSSHHHHHHHHHHHCCGGGC
T ss_pred             cC---CCCCcHhhhhCcccCCCeECCCCHHHHHHHHHHhCChhhc
Confidence            98   6999999999999999999999999999999999988875
>d1wkja1 d.58.6.1 (A:1-137) Nucleoside diphosphate kinase, NDK {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nhkl_ d.58.6.1 (L:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d3bbba1 d.58.6.1 (A:2-151) Nucleoside diphosphate kinase, NDK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1zs6a1 d.58.6.1 (A:18-169) Nucleoside diphosphate kinase, NDK {Human(Homo sapiens), NDK3 [TaxId: 9606]} Back     information, alignment and structure
>d1nb2a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Bacillus halodenitrificans [TaxId: 1482]} Back     information, alignment and structure
>d1k44a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xiqa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1hlwa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1u8wa_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s57a_ d.58.6.1 (A:) Nucleoside diphosphate kinase, NDK {Thale cress (Arabidopsis thaliana), chloroplast NDK2 [TaxId: 3702]} Back     information, alignment and structure
>d2az3a1 d.58.6.1 (A:4-155) Nucleoside diphosphate kinase, NDK {Archaeon Halobacterium salinarum [TaxId: 2242]} Back     information, alignment and structure
>d2dyaa1 d.58.6.1 (A:6-158) Nucleoside diphosphate kinase, NDK {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xqia1 d.58.6.1 (A:14-195) Nucleoside diphosphate kinase, NDK {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d2b8qa1 d.58.6.1 (A:2-129) Nucleoside diphosphate kinase, NDK {Mimivirus [TaxId: 315393]} Back     information, alignment and structure