Diaphorina citri psyllid: psy8253


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVIR
ccccccccccEEEEEEccccccccccEEEEEcccEEEEEEccccccEEEEEEEEcccccccEEEEEEEEccccccCEEEEccccCEEc
*****DHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polycomb protein EED Polycomb group (PcG) protein (By similarity). Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene (By similarity). The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems.confidentQ3SZ25
Polycomb protein EED Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene.confidentQ5ZKH3
Polycomb protein EED Polycomb group (PcG) protein. Component of the PRC2/EED-EZH2 complex, which methylates 'Lys-9' and 'Lys-27' of histone H3, leading to transcriptional repression of the affected target gene. The PRC2/EED-EZH2 complex may also serve as a recruiting platform for DNA methyltransferases, thereby linking two epigenetic repression systems. Genes repressed by the PRC2/EED-EZH2 complex include HOXC8, HOXA9, MYT1 and CDKN2A.confidentO75530

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035098 [CC]ESC/E(Z) complexprobableGO:0031974, GO:0043229, GO:0035097, GO:0043227, GO:0043226, GO:0034708, GO:0005575, GO:0031519, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0042054 [MF]histone methyltransferase activityprobableGO:0003824, GO:0016741, GO:0016740, GO:0008276, GO:0003674, GO:0008168
GO:0031062 [BP]positive regulation of histone methylationprobableGO:0033044, GO:0009893, GO:0019222, GO:0033043, GO:0031325, GO:0031323, GO:0051128, GO:0031056, GO:0031058, GO:0050789, GO:0080090, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0051130, GO:0060255, GO:0050794, GO:0031060, GO:0032268, GO:0031401, GO:0010638, GO:0008150, GO:2001252, GO:0048522
GO:0016571 [BP]histone methylationprobableGO:0006479, GO:0008213, GO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0016043, GO:0071704, GO:0016570, GO:0032259, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0043414, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044763, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0031491 [MF]nucleosome bindingprobableGO:0003682, GO:0003674, GO:0005488
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0008047 [MF]enzyme activator activityprobableGO:0030234, GO:0003674
GO:0001739 [CC]sex chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0000803, GO:0044454, GO:0005694, GO:0000792, GO:0000790, GO:0005720, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0045120 [CC]pronucleusprobableGO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3K26, chain A
Confidence level:very confident
Coverage over the Query: 2-88
View the alignment between query and template
View the model in PyMOL