Psyllid ID: psy8253


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVIR
ccccccccccEEEEEEccccccccccEEEEEcccEEEEEEccccccEEEEEEEEcccccccEEEEEEEEccccccEEEEEccccEEEc
ccccccccccEEEEEEccccccccccEEEEEcccEEEEEEEcccccEEEEEEEEcccccccEEEEEEEEcccccccEEEEEccccEEc
cshkedhgqplfgaqfnhllkddqprifatvgsnrvsiyecpdggsikllqcyadpdieenfYTCAWsmdlesgrpllavagsravir
cshkedhgqpLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLesgrpllavagsravir
CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVIR
***********FGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAV********
*****DHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVI*
********QPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVIR
C****DHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVIR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRAVIR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
O16023 428 Polycomb protein esc OS=M N/A N/A 1.0 0.205 0.636 2e-28
Q566T0 443 Polycomb protein eed OS=D yes N/A 0.988 0.196 0.655 6e-28
Q5ZKH3 446 Polycomb protein EED OS=G yes N/A 0.988 0.195 0.643 1e-27
Q24338 425 Polycomb protein esc OS=D yes N/A 0.965 0.2 0.623 3e-27
Q3SZ25 441 Polycomb protein EED OS=B yes N/A 0.988 0.197 0.632 5e-27
Q921E6 441 Polycomb protein EED OS=M yes N/A 0.988 0.197 0.632 5e-27
O75530 441 Polycomb protein EED OS=H yes N/A 0.988 0.197 0.632 5e-27
Q28DT7 438 Polycomb protein eed OS=X yes N/A 0.988 0.198 0.632 7e-27
Q6AZS2 438 Polycomb protein eed-B OS N/A N/A 0.988 0.198 0.632 7e-27
Q8UUP2 438 Polycomb protein eed-A OS N/A N/A 0.988 0.198 0.632 7e-27
>sp|O16023|ESC_MUSDO Polycomb protein esc OS=Musca domestica GN=esc PE=3 SV=1 Back     alignment and function desciption
 Score =  124 bits (311), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 56/88 (63%), Positives = 65/88 (73%)

Query: 1   CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEE 60
           C  KEDHGQ +FG  FNHLL  DQ  +FAT GSNR +IYECP  G +KL+ CYADPD +E
Sbjct: 67  CHLKEDHGQAIFGVSFNHLLGKDQSMVFATAGSNRCNIYECPRKGGLKLIMCYADPDPDE 126

Query: 61  NFYTCAWSMDLESGRPLLAVAGSRAVIR 88
            FYTC+WS DL++  PLLA AG R VIR
Sbjct: 127 VFYTCSWSYDLKTSAPLLATAGYRGVIR 154




Polycomb group (PcG) protein. In contrast to other PcG protein, it is specifically required during the first 6 hours of embryogenesis to establish PcG silencing. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. PcG proteins are not required to initiate repression, but to maintain it during later stages of development. They probably act via a methylation of histones, rendering chromatin heritably changed in its expressibility. Component of the Esc/E(z) complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. The Esc/E(z) complex is necessary but not sufficient to recruit a functional PcG repressive complex that represses target genes, suggesting that the recruitment of the distinct PRC1 complex is also required to allow a subsequent repression.
Musca domestica (taxid: 7370)
>sp|Q566T0|EED_DANRE Polycomb protein eed OS=Danio rerio GN=eed PE=2 SV=2 Back     alignment and function description
>sp|Q5ZKH3|EED_CHICK Polycomb protein EED OS=Gallus gallus GN=EED PE=2 SV=1 Back     alignment and function description
>sp|Q24338|ESC_DROME Polycomb protein esc OS=Drosophila melanogaster GN=esc PE=1 SV=1 Back     alignment and function description
>sp|Q3SZ25|EED_BOVIN Polycomb protein EED OS=Bos taurus GN=EED PE=2 SV=1 Back     alignment and function description
>sp|Q921E6|EED_MOUSE Polycomb protein EED OS=Mus musculus GN=Eed PE=1 SV=1 Back     alignment and function description
>sp|O75530|EED_HUMAN Polycomb protein EED OS=Homo sapiens GN=EED PE=1 SV=2 Back     alignment and function description
>sp|Q28DT7|EED_XENTR Polycomb protein eed OS=Xenopus tropicalis GN=eed PE=2 SV=1 Back     alignment and function description
>sp|Q6AZS2|EEDB_XENLA Polycomb protein eed-B OS=Xenopus laevis GN=eed-b PE=1 SV=2 Back     alignment and function description
>sp|Q8UUP2|EEDA_XENLA Polycomb protein eed-A OS=Xenopus laevis GN=eed-a PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
332373884 427 unknown [Dendroctonus ponderosae] 1.0 0.206 0.795 7e-36
2352418 437 extra sex combs [Schistocerca americana] 0.988 0.199 0.770 2e-34
321462210 426 hypothetical protein DAPPUDRAFT_307962 [ 0.965 0.199 0.752 2e-34
340710350 427 PREDICTED: polycomb protein eed-A-like [ 0.988 0.203 0.784 6e-34
91078148 423 PREDICTED: similar to extra sex combs [T 1.0 0.208 0.727 6e-34
270002345 430 hypothetical protein TcasGA2_TC001356 [T 1.0 0.204 0.727 7e-34
383850822 427 PREDICTED: polycomb protein eed-A-like [ 0.988 0.203 0.772 2e-33
350415901 427 PREDICTED: polycomb protein eed-A-like [ 0.988 0.203 0.761 4e-33
66559864 427 PREDICTED: polycomb protein eed-A-like [ 0.988 0.203 0.761 6e-33
380014722 427 PREDICTED: polycomb protein eed-A-like [ 0.988 0.203 0.761 6e-33
>gi|332373884|gb|AEE62083.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
 Score =  154 bits (388), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 70/88 (79%), Positives = 78/88 (88%)

Query: 1   CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEE 60
           CS KEDHGQPLFGAQFNH LK+ QP IFA VGSNRV+IYECP+ G IKL+QCYADPD++E
Sbjct: 74  CSIKEDHGQPLFGAQFNHHLKEGQPLIFAAVGSNRVTIYECPEAGGIKLVQCYADPDLDE 133

Query: 61  NFYTCAWSMDLESGRPLLAVAGSRAVIR 88
           NFYTCAWS D ESG+PLLAVAG+R VIR
Sbjct: 134 NFYTCAWSYDEESGKPLLAVAGARGVIR 161




Source: Dendroctonus ponderosae

Species: Dendroctonus ponderosae

Genus: Dendroctonus

Family: Curculionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|2352418|gb|AAC05332.1| extra sex combs [Schistocerca americana] Back     alignment and taxonomy information
>gi|321462210|gb|EFX73235.1| hypothetical protein DAPPUDRAFT_307962 [Daphnia pulex] Back     alignment and taxonomy information
>gi|340710350|ref|XP_003393755.1| PREDICTED: polycomb protein eed-A-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|91078148|ref|XP_973780.1| PREDICTED: similar to extra sex combs [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270002345|gb|EEZ98792.1| hypothetical protein TcasGA2_TC001356 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|383850822|ref|XP_003700973.1| PREDICTED: polycomb protein eed-A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350415901|ref|XP_003490784.1| PREDICTED: polycomb protein eed-A-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|66559864|ref|XP_623808.1| PREDICTED: polycomb protein eed-A-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380014722|ref|XP_003691369.1| PREDICTED: polycomb protein eed-A-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
ZFIN|ZDB-GENE-050417-287 443 eed "embryonic ectoderm develo 0.988 0.196 0.655 2.2e-27
UNIPROTKB|Q5ZKH3 446 EED "Polycomb protein EED" [Ga 0.988 0.195 0.643 7.9e-27
UNIPROTKB|F1P0V7 464 EED "Polycomb protein EED" [Ga 0.988 0.187 0.643 1.2e-26
UNIPROTKB|Q3SZ25 441 EED "Polycomb protein EED" [Bo 0.988 0.197 0.632 3.7e-26
UNIPROTKB|F1PP86 441 EED "Uncharacterized protein" 0.988 0.197 0.632 3.7e-26
UNIPROTKB|O75530 441 EED "Polycomb protein EED" [Ho 0.988 0.197 0.632 3.7e-26
MGI|MGI:95286 441 Eed "embryonic ectoderm develo 0.988 0.197 0.632 3.7e-26
UNIPROTKB|Q28DT7 438 eed "Polycomb protein eed" [Xe 0.988 0.198 0.632 4.6e-26
UNIPROTKB|Q6AZS2 438 eed-b "Polycomb protein eed-B" 0.988 0.198 0.632 4.6e-26
UNIPROTKB|Q8UUP2 438 eed-a "Polycomb protein eed-A" 0.988 0.198 0.632 4.6e-26
ZFIN|ZDB-GENE-050417-287 eed "embryonic ectoderm development" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 307 (113.1 bits), Expect = 2.2e-27, P = 2.2e-27
 Identities = 57/87 (65%), Positives = 65/87 (74%)

Query:     2 SHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEEN 61
             S KEDHGQPLFG QFN   K+  P +FATVGSNRV++YEC   G I+LLQ Y D D +EN
Sbjct:    89 SLKEDHGQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADEN 148

Query:    62 FYTCAWSMDLESGRPLLAVAGSRAVIR 88
             FYTCAW+ D  S  PLLAVAGSR +IR
Sbjct:   149 FYTCAWTFDCSSSHPLLAVAGSRGIIR 175




GO:0035098 "ESC/E(Z) complex" evidence=ISS
GO:0005634 "nucleus" evidence=IEA
GO:0006351 "transcription, DNA-dependent" evidence=IEA
GO:0016568 "chromatin modification" evidence=IEA
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IEA
UNIPROTKB|Q5ZKH3 EED "Polycomb protein EED" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P0V7 EED "Polycomb protein EED" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3SZ25 EED "Polycomb protein EED" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PP86 EED "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O75530 EED "Polycomb protein EED" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:95286 Eed "embryonic ectoderm development" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q28DT7 eed "Polycomb protein eed" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q6AZS2 eed-b "Polycomb protein eed-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q8UUP2 eed-a "Polycomb protein eed-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q3SZ25EED_BOVINNo assigned EC number0.63210.98860.1972yesN/A
Q5ZKH3EED_CHICKNo assigned EC number0.64360.98860.1950yesN/A
O75530EED_HUMANNo assigned EC number0.63210.98860.1972yesN/A
Q24338ESC_DROMENo assigned EC number0.62350.96590.2yesN/A
Q28DT7EED_XENTRNo assigned EC number0.63210.98860.1986yesN/A
Q566T0EED_DANRENo assigned EC number0.65510.98860.1963yesN/A
Q921E6EED_MOUSENo assigned EC number0.63210.98860.1972yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
KOG1034|consensus 385 99.97
KOG0277|consensus 311 99.22
KOG0264|consensus422 98.28
KOG0645|consensus 312 98.08
KOG2445|consensus 361 98.04
KOG0273|consensus524 97.98
PTZ00421 493 coronin; Provisional 97.88
KOG0296|consensus 399 97.87
KOG0318|consensus 603 97.85
PTZ00421 493 coronin; Provisional 97.79
KOG0272|consensus459 97.7
PTZ00420 568 coronin; Provisional 97.7
KOG2445|consensus361 97.65
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 97.62
KOG0277|consensus311 97.48
KOG1007|consensus370 97.44
cd00200 289 WD40 WD40 domain, found in a number of eukaryotic 97.3
KOG0271|consensus 480 97.3
PTZ00420 568 coronin; Provisional 97.27
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 97.17
KOG0302|consensus 440 97.13
PLN00181 793 protein SPA1-RELATED; Provisional 97.09
KOG0290|consensus364 97.07
KOG0264|consensus 422 96.99
KOG0322|consensus323 96.98
KOG1587|consensus555 96.9
KOG0316|consensus 307 96.89
KOG0266|consensus 456 96.89
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 96.8
KOG0319|consensus 775 96.78
KOG0310|consensus 487 96.77
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 96.76
KOG0310|consensus 487 96.7
KOG2110|consensus 391 96.65
KOG1538|consensus 1081 96.62
KOG0263|consensus707 96.56
KOG0266|consensus 456 96.52
KOG0303|consensus 472 96.51
PLN00181 793 protein SPA1-RELATED; Provisional 96.49
KOG0318|consensus603 96.49
KOG0263|consensus 707 96.48
KOG1332|consensus299 96.38
KOG0284|consensus 464 96.37
KOG0772|consensus 641 96.24
KOG0319|consensus 775 96.02
KOG2394|consensus 636 95.95
KOG1009|consensus 434 95.94
KOG0273|consensus524 95.93
KOG0641|consensus 350 95.86
KOG1445|consensus 1012 95.82
KOG0272|consensus459 95.82
KOG0315|consensus311 95.81
KOG0268|consensus433 95.66
KOG0271|consensus 480 95.61
KOG1310|consensus 758 95.6
KOG2111|consensus346 95.59
KOG0645|consensus 312 95.59
KOG0293|consensus 519 95.58
KOG1273|consensus 405 95.56
KOG0973|consensus 942 95.45
KOG0265|consensus 338 95.41
KOG1009|consensus 434 95.25
KOG0276|consensus 794 95.17
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 94.94
KOG0315|consensus 311 94.78
KOG0279|consensus315 94.5
KOG1332|consensus 299 94.42
KOG0647|consensus 347 94.35
KOG0293|consensus 519 94.28
KOG0301|consensus 745 94.24
KOG1274|consensus 933 94.19
KOG0307|consensus 1049 94.16
KOG0284|consensus 464 94.1
KOG0641|consensus 350 93.68
KOG0279|consensus 315 93.64
KOG0290|consensus 364 93.28
KOG0647|consensus 347 93.26
KOG1063|consensus764 93.22
KOG4378|consensus 673 93.15
KOG0305|consensus484 93.01
KOG0305|consensus 484 92.79
KOG1524|consensus 737 92.77
KOG0268|consensus 433 92.68
smart0032040 WD40 WD40 repeats. Note that these repeats are per 92.61
KOG0269|consensus 839 92.5
KOG1407|consensus313 92.41
KOG1587|consensus 555 92.15
KOG0291|consensus 893 92.06
KOG0269|consensus 839 92.01
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 91.97
KOG4328|consensus 498 91.83
PF15390 671 DUF4613: Domain of unknown function (DUF4613) 91.68
KOG1645|consensus 463 91.62
COG2319 466 FOG: WD40 repeat [General function prediction only 91.55
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 91.36
KOG2055|consensus 514 91.3
KOG1445|consensus 1012 91.01
KOG0283|consensus 712 90.98
KOG0973|consensus 942 90.81
TIGR03866 300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 90.06
KOG1523|consensus 361 89.4
KOG0288|consensus459 89.25
KOG0270|consensus463 88.86
KOG0772|consensus 641 88.54
PF1415763 YmzC: YmzC-like protein; PDB: 3KVP_E. 88.29
KOG1539|consensus 910 87.93
KOG1007|consensus370 87.88
KOG2106|consensus 626 87.8
KOG2048|consensus 691 87.55
KOG0302|consensus440 87.46
KOG0282|consensus 503 87.26
KOG0640|consensus 430 87.19
KOG1063|consensus 764 87.12
KOG0286|consensus343 87.06
KOG4283|consensus 397 86.75
KOG0307|consensus 1049 86.48
KOG0295|consensus406 86.2
KOG2111|consensus346 85.84
KOG0313|consensus423 85.5
KOG1407|consensus313 84.76
KOG4532|consensus 344 84.38
KOG1523|consensus 361 84.26
KOG1036|consensus 323 83.99
KOG2055|consensus 514 83.75
KOG0640|consensus 430 83.73
KOG0291|consensus 893 83.56
KOG1538|consensus 1081 83.49
KOG0316|consensus 307 83.33
KOG0265|consensus 338 83.25
KOG0649|consensus 325 82.94
KOG1036|consensus 323 82.53
KOG0285|consensus 460 82.31
KOG0283|consensus 712 81.63
KOG0308|consensus 735 81.36
KOG1034|consensus 385 80.38
KOG0771|consensus 398 80.31
KOG0389|consensus941 80.11
>KOG1034|consensus Back     alignment and domain information
Probab=99.97  E-value=3.6e-30  Score=192.41  Aligned_cols=87  Identities=57%  Similarity=1.075  Sum_probs=85.0

Q ss_pred             cccccCCCCeEEEEEecCCCCCCCCEEEEeCCCeEEEEEcCCCCCeeEEEEEEcCCCCCceeEEEEeecCCCCceEEEEe
Q psy8253           2 SHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVA   81 (88)
Q Consensus         2 ~~~e~h~~~~y~v~Fnp~~~~~~~~~fAtvG~~~v~Vy~~~~~~~~~~l~~~~d~d~~e~~y~~aWs~d~~~~~plLa~a   81 (88)
                      +++|+|+.+||||+||+|...++.++|||+|++|++||+|+-++.+.+||+|.|+|++|+||||||++|..+++|+||+|
T Consensus        32 ~l~ed~~~~I~gv~fN~~~~~~e~~vfatvG~~rvtiy~c~~d~~ir~lq~y~D~d~~Esfytcsw~yd~~~~~p~la~~  111 (385)
T KOG1034|consen   32 HLKEDHNKPIFGVAFNSFLGCDEPQVFATVGGNRVTIYECPGDGGIRLLQSYADEDHDESFYTCSWSYDSNTGNPFLAAG  111 (385)
T ss_pred             ehhccCCCccceeeeehhcCCCCCceEEEeCCcEEEEEEECCccceeeeeeccCCCCCcceEEEEEEecCCCCCeeEEee
Confidence            78999999999999999999999999999999999999999999999999999999999999999999988899999999


Q ss_pred             cCCcEeC
Q psy8253          82 GSRAVIR   88 (88)
Q Consensus        82 G~~G~Ir   88 (88)
                      |.+|+||
T Consensus       112 G~~GvIr  118 (385)
T KOG1034|consen  112 GYLGVIR  118 (385)
T ss_pred             cceeEEE
Confidence            9999997



>KOG0277|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>PF14157 YmzC: YmzC-like protein; PDB: 3KVP_E Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
3iiy_A 365 Crystal Structure Of Eed In Complex With A Trimethy 4e-28
3jzn_A 366 Structure Of Eed In Apo Form Length = 366 4e-28
3iiw_A 365 Crystal Structure Of Eed In Complex With A Trimethy 4e-28
2qxv_A 361 Structural Basis Of Ezh2 Recognition By Eed Length 4e-28
3jpx_A 402 Eed: A Novel Histone Trimethyllysine Binder Within 5e-28
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure

Iteration: 1

Score = 119 bits (298), Expect = 4e-28, Method: Compositional matrix adjust. Identities = 55/87 (63%), Positives = 64/87 (73%) Query: 2 SHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEEN 61 S KEDH QPLFG QFN K+ P +FATVGSNRV++YEC G I+LLQ Y D D +EN Sbjct: 11 SLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADEN 70 Query: 62 FYTCAWSMDLESGRPLLAVAGSRAVIR 88 FYTCAW+ D + PLLAVAGSR +IR Sbjct: 71 FYTCAWTYDSNTSHPLLAVAGSRGIIR 97
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 7e-22
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 Back     alignment and structure
 Score = 85.8 bits (213), Expect = 7e-22
 Identities = 54/85 (63%), Positives = 63/85 (74%)

Query: 4  KEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFY 63
          KEDH QPLFG QFN   K+  P +FATVGSNRV++YEC   G I+LLQ Y D D +ENFY
Sbjct: 14 KEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFY 73

Query: 64 TCAWSMDLESGRPLLAVAGSRAVIR 88
          TCAW+ D  +  PLLAVAGSR +IR
Sbjct: 74 TCAWTYDSNTSHPLLAVAGSRGIIR 98


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 99.31
4aow_A 340 Guanine nucleotide-binding protein subunit beta-2; 98.4
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 98.35
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 98.34
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 98.34
2pm7_B297 Protein transport protein SEC13, protein transport 98.3
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 98.26
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 98.25
2pm7_B 297 Protein transport protein SEC13, protein transport 98.2
1gxr_A 337 ESG1, transducin-like enhancer protein 1; transcri 98.2
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 98.19
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.17
3ow8_A 321 WD repeat-containing protein 61; structural genomi 98.17
4gq1_A 393 NUP37; propeller, transport protein; 2.40A {Schizo 98.16
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 98.14
3i2n_A 357 WD repeat-containing protein 92; WD40 repeats, str 98.13
3jrp_A 379 Fusion protein of protein transport protein SEC13 98.11
4g56_B357 MGC81050 protein; protein arginine methyltransfera 98.11
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 98.1
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 98.1
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 98.1
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 98.08
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 98.07
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 98.06
3ow8_A321 WD repeat-containing protein 61; structural genomi 98.06
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 98.05
1vyh_C 410 Platelet-activating factor acetylhydrolase IB alph 98.02
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 98.0
2ymu_A 577 WD-40 repeat protein; unknown function, two domain 97.99
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.99
4gqb_B 344 Methylosome protein 50; TIM barrel, beta-propeller 97.97
2ynn_A 304 Coatomer subunit beta'; protein transport, peptide 97.96
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.95
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.94
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 97.93
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 97.92
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 97.92
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.91
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 97.91
3frx_A 319 Guanine nucleotide-binding protein subunit beta- l 97.91
2xzm_R 343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 97.9
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 97.9
3jrp_A379 Fusion protein of protein transport protein SEC13 97.9
3f3f_A 351 Nucleoporin SEH1; structural protein, protein comp 97.89
1got_B 340 GT-beta; complex (GTP-binding/transducer), G prote 97.89
2xyi_A 430 Probable histone-binding protein CAF1; transcripti 97.89
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 97.86
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 97.85
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.85
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 97.85
3iz6_a 380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.84
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.84
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.83
4ery_A 312 WD repeat-containing protein 5; WD40, WIN motif, b 97.83
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 97.82
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 97.82
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.81
3dw8_B 447 Serine/threonine-protein phosphatase 2A 55 kDa RE 97.81
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 97.8
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 97.79
3k26_A 366 Polycomb protein EED; WD40, structural genomics, N 97.78
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 97.78
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 97.78
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 97.76
2pbi_B 354 Guanine nucleotide-binding protein subunit beta 5; 97.75
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.74
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.74
4ggc_A 318 P55CDC, cell division cycle protein 20 homolog; ce 97.73
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 97.73
4g56_B 357 MGC81050 protein; protein arginine methyltransfera 97.72
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 97.71
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 97.71
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.7
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 97.7
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.68
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 97.68
3odt_A 313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.66
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.63
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 97.61
2ymu_A577 WD-40 repeat protein; unknown function, two domain 97.61
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 97.58
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 97.57
1r5m_A 425 SIR4-interacting protein SIF2; transcription corep 97.57
4gga_A 420 P55CDC, cell division cycle protein 20 homolog; ce 97.57
3jro_A 753 Fusion protein of protein transport protein SEC13 97.57
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.55
2xyi_A430 Probable histone-binding protein CAF1; transcripti 97.55
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 97.55
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 97.52
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.49
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 97.45
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 97.44
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 97.43
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.43
1erj_A 393 Transcriptional repressor TUP1; beta-propeller, tr 97.43
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 97.42
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 97.42
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 97.41
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.4
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.4
3jro_A 753 Fusion protein of protein transport protein SEC13 97.38
3zwl_B 369 Eukaryotic translation initiation factor 3 subuni; 97.37
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 97.34
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 97.34
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.32
4h5i_A 365 Guanine nucleotide-exchange factor SEC12; copii ve 97.26
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.24
3v7d_B 464 Cell division control protein 4; WD 40 domain, pho 97.22
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.13
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.09
2oaj_A 902 Protein SNI1; WD40 repeat, beta propeller, endocyt 97.08
3vl1_A 420 26S proteasome regulatory subunit RPN14; beta-prop 97.07
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.0
2j04_B 524 YDR362CP, TAU91; beta propeller, type 2 promoters, 97.0
2oit_A 434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 96.86
1yfq_A 342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.72
3vu4_A 355 KMHSV2; beta-propeller fold, protein transport; 2. 96.72
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.52
2j04_A 588 TAU60, YPL007P, hypothetical protein YPL007C; beta 96.43
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.4
1p22_A 435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 96.39
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 96.36
2ovr_B 445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 96.23
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 96.08
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 95.92
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 95.9
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 95.75
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 95.5
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 95.39
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.31
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 95.25
1ri6_A 343 Putative isomerase YBHE; 7-bladed propeller, enzym 95.18
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 95.1
3hfq_A 347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 94.94
2ojh_A 297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 94.84
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 94.32
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 94.25
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 93.98
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 93.2
3u4y_A 331 Uncharacterized protein; structural genomics, PSI- 93.04
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 92.24
3scy_A 361 Hypothetical bacterial 6-phosphogluconolactonase; 91.01
3kvp_A72 Uncharacterized protein YMZC; structural genomics, 90.91
2hqs_A 415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 90.73
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 90.63
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 89.34
1xip_A 388 Nucleoporin NUP159; beta-propeller, transport prot 89.21
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 88.28
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 88.22
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 87.69
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 87.22
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 86.31
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 84.69
1pby_B 337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 84.29
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 83.25
1k32_A 1045 Tricorn protease; protein degradation, substrate g 83.01
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 82.49
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 81.65
1k32_A 1045 Tricorn protease; protein degradation, substrate g 81.04
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 80.31
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
Probab=99.31  E-value=2.6e-11  Score=83.86  Aligned_cols=87  Identities=63%  Similarity=1.092  Sum_probs=76.4

Q ss_pred             cccccCCCCeEEEEEecCCCCCCCCEEEEeCCCeEEEEEcCCCCCeeEEEEEEcCCCCCceeEEEEeecCCCCceEEEEe
Q psy8253           2 SHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVA   81 (88)
Q Consensus         2 ~~~e~h~~~~y~v~Fnp~~~~~~~~~fAtvG~~~v~Vy~~~~~~~~~~l~~~~d~d~~e~~y~~aWs~d~~~~~plLa~a   81 (88)
                      .+++.|..+|++++|+|..+.+...++|+.+.+.|.||++..++.+..++.+.++.+++.+++++|+.+...+..+|++|
T Consensus        12 ~~~~~h~~~v~~i~~~p~~~~~~~~~~~~~~~~~v~vw~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~l~~~   91 (366)
T 3k26_A           12 SLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVA   91 (366)
T ss_dssp             EEECTTCSCEEEEEECTTCCTTSCEEEEEEETTEEEEEEECGGGCEEEEEEEECSCTTCCEEEEEEEECTTTCCEEEEEE
T ss_pred             EeecCCCCceEEEEEecccCCCCceEEEECCCCEEEEEEcCCCcEEEeeeeccccCCCCcEEEEEeccCCCCCCCEEEEe
Confidence            46778999999999999865566789999999999999999887889999998888899999999999965546789999


Q ss_pred             cCCcEeC
Q psy8253          82 GSRAVIR   88 (88)
Q Consensus        82 G~~G~Ir   88 (88)
                      +.+|.|+
T Consensus        92 ~~dg~i~   98 (366)
T 3k26_A           92 GSRGIIR   98 (366)
T ss_dssp             ETTCEEE
T ss_pred             cCCCEEE
Confidence            9999885



>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3kvp_A Uncharacterized protein YMZC; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.40A {Bacillus subtilis} Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d1gxra_ 337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.63
d1yfqa_ 342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 98.58
d1erja_ 388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 98.39
d1tbga_ 340 beta1-subunit of the signal-transducing G protein 98.32
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 98.29
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 98.23
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 98.18
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.1
d1tbga_340 beta1-subunit of the signal-transducing G protein 98.1
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 98.06
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 98.0
d1vyhc1 317 Platelet-activating factor acetylhydrolase IB subu 97.9
d1nr0a2 299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.83
d1nr0a1 311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.73
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.66
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 97.65
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.59
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.54
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 97.53
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.53
d1p22a2 293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 97.51
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 97.41
d2ovrb2 342 F-box/WD repeat-containing protein 7, FBXW7 {Human 97.37
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 97.33
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 97.15
d1nexb2 355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 97.12
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 97.08
d1sq9a_ 393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 97.05
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.79
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 96.56
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 96.38
d1pbyb_ 337 Quinohemoprotein amine dehydrogenase B chain {Para 96.19
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 96.16
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 96.06
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.3
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.2
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 94.78
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 94.55
d1l0qa2 301 Surface layer protein {Archaeon Methanosarcina maz 93.81
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 90.1
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 89.28
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 88.21
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 87.46
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 86.43
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Groucho/tle1, C-terminal domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.63  E-value=7.9e-08  Score=65.41  Aligned_cols=74  Identities=16%  Similarity=0.259  Sum_probs=60.7

Q ss_pred             cCCCCeEEEEEecCCCCCCCCEEEEeCCCeEEEEEcCCCCCeeEEEEEEcCCCCCceeEEEEeecCCCCceEEEEecCCc
Q psy8253           6 DHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRA   85 (88)
Q Consensus         6 ~h~~~~y~v~Fnp~~~~~~~~~fAtvG~~~v~Vy~~~~~~~~~~l~~~~d~d~~e~~y~~aWs~d~~~~~plLa~aG~~G   85 (88)
                      .|..++.+++|+|     ..+.+||.|.+.|.|+++...+....+.......++..+.+++|+.+    ..+|++|+.+|
T Consensus        49 ~H~~~V~~v~fs~-----~g~~latg~dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~d----g~~l~s~~~dg  119 (337)
T d1gxra_          49 NHGEVVCAVTISN-----PTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPD----GCTLIVGGEAS  119 (337)
T ss_dssp             CCSSCCCEEEECS-----SSSEEEEECBSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTT----SSEEEEEESSS
T ss_pred             CCCCcEEEEEECC-----CCCEEEEEECCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCC----CCEEEEeeccc
Confidence            6889999999987     35779999988999999988766556666655567888999999976    34699999999


Q ss_pred             EeC
Q psy8253          86 VIR   88 (88)
Q Consensus        86 ~Ir   88 (88)
                      .|+
T Consensus       120 ~i~  122 (337)
T d1gxra_         120 TLS  122 (337)
T ss_dssp             EEE
T ss_pred             ccc
Confidence            885



>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure