Psyllid ID: psy8253
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| 332373884 | 427 | unknown [Dendroctonus ponderosae] | 1.0 | 0.206 | 0.795 | 7e-36 | |
| 2352418 | 437 | extra sex combs [Schistocerca americana] | 0.988 | 0.199 | 0.770 | 2e-34 | |
| 321462210 | 426 | hypothetical protein DAPPUDRAFT_307962 [ | 0.965 | 0.199 | 0.752 | 2e-34 | |
| 340710350 | 427 | PREDICTED: polycomb protein eed-A-like [ | 0.988 | 0.203 | 0.784 | 6e-34 | |
| 91078148 | 423 | PREDICTED: similar to extra sex combs [T | 1.0 | 0.208 | 0.727 | 6e-34 | |
| 270002345 | 430 | hypothetical protein TcasGA2_TC001356 [T | 1.0 | 0.204 | 0.727 | 7e-34 | |
| 383850822 | 427 | PREDICTED: polycomb protein eed-A-like [ | 0.988 | 0.203 | 0.772 | 2e-33 | |
| 350415901 | 427 | PREDICTED: polycomb protein eed-A-like [ | 0.988 | 0.203 | 0.761 | 4e-33 | |
| 66559864 | 427 | PREDICTED: polycomb protein eed-A-like [ | 0.988 | 0.203 | 0.761 | 6e-33 | |
| 380014722 | 427 | PREDICTED: polycomb protein eed-A-like [ | 0.988 | 0.203 | 0.761 | 6e-33 |
| >gi|332373884|gb|AEE62083.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
Score = 154 bits (388), Expect = 7e-36, Method: Compositional matrix adjust.
Identities = 70/88 (79%), Positives = 78/88 (88%)
Query: 1 CSHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEE 60
CS KEDHGQPLFGAQFNH LK+ QP IFA VGSNRV+IYECP+ G IKL+QCYADPD++E
Sbjct: 74 CSIKEDHGQPLFGAQFNHHLKEGQPLIFAAVGSNRVTIYECPEAGGIKLVQCYADPDLDE 133
Query: 61 NFYTCAWSMDLESGRPLLAVAGSRAVIR 88
NFYTCAWS D ESG+PLLAVAG+R VIR
Sbjct: 134 NFYTCAWSYDEESGKPLLAVAGARGVIR 161
|
Source: Dendroctonus ponderosae Species: Dendroctonus ponderosae Genus: Dendroctonus Family: Curculionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|2352418|gb|AAC05332.1| extra sex combs [Schistocerca americana] | Back alignment and taxonomy information |
|---|
| >gi|321462210|gb|EFX73235.1| hypothetical protein DAPPUDRAFT_307962 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|340710350|ref|XP_003393755.1| PREDICTED: polycomb protein eed-A-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|91078148|ref|XP_973780.1| PREDICTED: similar to extra sex combs [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|270002345|gb|EEZ98792.1| hypothetical protein TcasGA2_TC001356 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383850822|ref|XP_003700973.1| PREDICTED: polycomb protein eed-A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|350415901|ref|XP_003490784.1| PREDICTED: polycomb protein eed-A-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|66559864|ref|XP_623808.1| PREDICTED: polycomb protein eed-A-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380014722|ref|XP_003691369.1| PREDICTED: polycomb protein eed-A-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 88 | ||||||
| ZFIN|ZDB-GENE-050417-287 | 443 | eed "embryonic ectoderm develo | 0.988 | 0.196 | 0.655 | 2.2e-27 | |
| UNIPROTKB|Q5ZKH3 | 446 | EED "Polycomb protein EED" [Ga | 0.988 | 0.195 | 0.643 | 7.9e-27 | |
| UNIPROTKB|F1P0V7 | 464 | EED "Polycomb protein EED" [Ga | 0.988 | 0.187 | 0.643 | 1.2e-26 | |
| UNIPROTKB|Q3SZ25 | 441 | EED "Polycomb protein EED" [Bo | 0.988 | 0.197 | 0.632 | 3.7e-26 | |
| UNIPROTKB|F1PP86 | 441 | EED "Uncharacterized protein" | 0.988 | 0.197 | 0.632 | 3.7e-26 | |
| UNIPROTKB|O75530 | 441 | EED "Polycomb protein EED" [Ho | 0.988 | 0.197 | 0.632 | 3.7e-26 | |
| MGI|MGI:95286 | 441 | Eed "embryonic ectoderm develo | 0.988 | 0.197 | 0.632 | 3.7e-26 | |
| UNIPROTKB|Q28DT7 | 438 | eed "Polycomb protein eed" [Xe | 0.988 | 0.198 | 0.632 | 4.6e-26 | |
| UNIPROTKB|Q6AZS2 | 438 | eed-b "Polycomb protein eed-B" | 0.988 | 0.198 | 0.632 | 4.6e-26 | |
| UNIPROTKB|Q8UUP2 | 438 | eed-a "Polycomb protein eed-A" | 0.988 | 0.198 | 0.632 | 4.6e-26 |
| ZFIN|ZDB-GENE-050417-287 eed "embryonic ectoderm development" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 307 (113.1 bits), Expect = 2.2e-27, P = 2.2e-27
Identities = 57/87 (65%), Positives = 65/87 (74%)
Query: 2 SHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEEN 61
S KEDHGQPLFG QFN K+ P +FATVGSNRV++YEC G I+LLQ Y D D +EN
Sbjct: 89 SLKEDHGQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADEN 148
Query: 62 FYTCAWSMDLESGRPLLAVAGSRAVIR 88
FYTCAW+ D S PLLAVAGSR +IR
Sbjct: 149 FYTCAWTFDCSSSHPLLAVAGSRGIIR 175
|
|
| UNIPROTKB|Q5ZKH3 EED "Polycomb protein EED" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P0V7 EED "Polycomb protein EED" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3SZ25 EED "Polycomb protein EED" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PP86 EED "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O75530 EED "Polycomb protein EED" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:95286 Eed "embryonic ectoderm development" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q28DT7 eed "Polycomb protein eed" [Xenopus (Silurana) tropicalis (taxid:8364)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q6AZS2 eed-b "Polycomb protein eed-B" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8UUP2 eed-a "Polycomb protein eed-A" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| KOG1034|consensus | 385 | 99.97 | ||
| KOG0277|consensus | 311 | 99.22 | ||
| KOG0264|consensus | 422 | 98.28 | ||
| KOG0645|consensus | 312 | 98.08 | ||
| KOG2445|consensus | 361 | 98.04 | ||
| KOG0273|consensus | 524 | 97.98 | ||
| PTZ00421 | 493 | coronin; Provisional | 97.88 | |
| KOG0296|consensus | 399 | 97.87 | ||
| KOG0318|consensus | 603 | 97.85 | ||
| PTZ00421 | 493 | coronin; Provisional | 97.79 | |
| KOG0272|consensus | 459 | 97.7 | ||
| PTZ00420 | 568 | coronin; Provisional | 97.7 | |
| KOG2445|consensus | 361 | 97.65 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 97.62 | |
| KOG0277|consensus | 311 | 97.48 | ||
| KOG1007|consensus | 370 | 97.44 | ||
| cd00200 | 289 | WD40 WD40 domain, found in a number of eukaryotic | 97.3 | |
| KOG0271|consensus | 480 | 97.3 | ||
| PTZ00420 | 568 | coronin; Provisional | 97.27 | |
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 97.17 | |
| KOG0302|consensus | 440 | 97.13 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 97.09 | |
| KOG0290|consensus | 364 | 97.07 | ||
| KOG0264|consensus | 422 | 96.99 | ||
| KOG0322|consensus | 323 | 96.98 | ||
| KOG1587|consensus | 555 | 96.9 | ||
| KOG0316|consensus | 307 | 96.89 | ||
| KOG0266|consensus | 456 | 96.89 | ||
| PF00400 | 39 | WD40: WD domain, G-beta repeat; InterPro: IPR01978 | 96.8 | |
| KOG0319|consensus | 775 | 96.78 | ||
| KOG0310|consensus | 487 | 96.77 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 96.76 | |
| KOG0310|consensus | 487 | 96.7 | ||
| KOG2110|consensus | 391 | 96.65 | ||
| KOG1538|consensus | 1081 | 96.62 | ||
| KOG0263|consensus | 707 | 96.56 | ||
| KOG0266|consensus | 456 | 96.52 | ||
| KOG0303|consensus | 472 | 96.51 | ||
| PLN00181 | 793 | protein SPA1-RELATED; Provisional | 96.49 | |
| KOG0318|consensus | 603 | 96.49 | ||
| KOG0263|consensus | 707 | 96.48 | ||
| KOG1332|consensus | 299 | 96.38 | ||
| KOG0284|consensus | 464 | 96.37 | ||
| KOG0772|consensus | 641 | 96.24 | ||
| KOG0319|consensus | 775 | 96.02 | ||
| KOG2394|consensus | 636 | 95.95 | ||
| KOG1009|consensus | 434 | 95.94 | ||
| KOG0273|consensus | 524 | 95.93 | ||
| KOG0641|consensus | 350 | 95.86 | ||
| KOG1445|consensus | 1012 | 95.82 | ||
| KOG0272|consensus | 459 | 95.82 | ||
| KOG0315|consensus | 311 | 95.81 | ||
| KOG0268|consensus | 433 | 95.66 | ||
| KOG0271|consensus | 480 | 95.61 | ||
| KOG1310|consensus | 758 | 95.6 | ||
| KOG2111|consensus | 346 | 95.59 | ||
| KOG0645|consensus | 312 | 95.59 | ||
| KOG0293|consensus | 519 | 95.58 | ||
| KOG1273|consensus | 405 | 95.56 | ||
| KOG0973|consensus | 942 | 95.45 | ||
| KOG0265|consensus | 338 | 95.41 | ||
| KOG1009|consensus | 434 | 95.25 | ||
| KOG0276|consensus | 794 | 95.17 | ||
| PF08662 | 194 | eIF2A: Eukaryotic translation initiation factor eI | 94.94 | |
| KOG0315|consensus | 311 | 94.78 | ||
| KOG0279|consensus | 315 | 94.5 | ||
| KOG1332|consensus | 299 | 94.42 | ||
| KOG0647|consensus | 347 | 94.35 | ||
| KOG0293|consensus | 519 | 94.28 | ||
| KOG0301|consensus | 745 | 94.24 | ||
| KOG1274|consensus | 933 | 94.19 | ||
| KOG0307|consensus | 1049 | 94.16 | ||
| KOG0284|consensus | 464 | 94.1 | ||
| KOG0641|consensus | 350 | 93.68 | ||
| KOG0279|consensus | 315 | 93.64 | ||
| KOG0290|consensus | 364 | 93.28 | ||
| KOG0647|consensus | 347 | 93.26 | ||
| KOG1063|consensus | 764 | 93.22 | ||
| KOG4378|consensus | 673 | 93.15 | ||
| KOG0305|consensus | 484 | 93.01 | ||
| KOG0305|consensus | 484 | 92.79 | ||
| KOG1524|consensus | 737 | 92.77 | ||
| KOG0268|consensus | 433 | 92.68 | ||
| smart00320 | 40 | WD40 WD40 repeats. Note that these repeats are per | 92.61 | |
| KOG0269|consensus | 839 | 92.5 | ||
| KOG1407|consensus | 313 | 92.41 | ||
| KOG1587|consensus | 555 | 92.15 | ||
| KOG0291|consensus | 893 | 92.06 | ||
| KOG0269|consensus | 839 | 92.01 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 91.97 | |
| KOG4328|consensus | 498 | 91.83 | ||
| PF15390 | 671 | DUF4613: Domain of unknown function (DUF4613) | 91.68 | |
| KOG1645|consensus | 463 | 91.62 | ||
| COG2319 | 466 | FOG: WD40 repeat [General function prediction only | 91.55 | |
| PF12894 | 47 | Apc4_WD40: Anaphase-promoting complex subunit 4 WD | 91.36 | |
| KOG2055|consensus | 514 | 91.3 | ||
| KOG1445|consensus | 1012 | 91.01 | ||
| KOG0283|consensus | 712 | 90.98 | ||
| KOG0973|consensus | 942 | 90.81 | ||
| TIGR03866 | 300 | PQQ_ABC_repeats PQQ-dependent catabolism-associate | 90.06 | |
| KOG1523|consensus | 361 | 89.4 | ||
| KOG0288|consensus | 459 | 89.25 | ||
| KOG0270|consensus | 463 | 88.86 | ||
| KOG0772|consensus | 641 | 88.54 | ||
| PF14157 | 63 | YmzC: YmzC-like protein; PDB: 3KVP_E. | 88.29 | |
| KOG1539|consensus | 910 | 87.93 | ||
| KOG1007|consensus | 370 | 87.88 | ||
| KOG2106|consensus | 626 | 87.8 | ||
| KOG2048|consensus | 691 | 87.55 | ||
| KOG0302|consensus | 440 | 87.46 | ||
| KOG0282|consensus | 503 | 87.26 | ||
| KOG0640|consensus | 430 | 87.19 | ||
| KOG1063|consensus | 764 | 87.12 | ||
| KOG0286|consensus | 343 | 87.06 | ||
| KOG4283|consensus | 397 | 86.75 | ||
| KOG0307|consensus | 1049 | 86.48 | ||
| KOG0295|consensus | 406 | 86.2 | ||
| KOG2111|consensus | 346 | 85.84 | ||
| KOG0313|consensus | 423 | 85.5 | ||
| KOG1407|consensus | 313 | 84.76 | ||
| KOG4532|consensus | 344 | 84.38 | ||
| KOG1523|consensus | 361 | 84.26 | ||
| KOG1036|consensus | 323 | 83.99 | ||
| KOG2055|consensus | 514 | 83.75 | ||
| KOG0640|consensus | 430 | 83.73 | ||
| KOG0291|consensus | 893 | 83.56 | ||
| KOG1538|consensus | 1081 | 83.49 | ||
| KOG0316|consensus | 307 | 83.33 | ||
| KOG0265|consensus | 338 | 83.25 | ||
| KOG0649|consensus | 325 | 82.94 | ||
| KOG1036|consensus | 323 | 82.53 | ||
| KOG0285|consensus | 460 | 82.31 | ||
| KOG0283|consensus | 712 | 81.63 | ||
| KOG0308|consensus | 735 | 81.36 | ||
| KOG1034|consensus | 385 | 80.38 | ||
| KOG0771|consensus | 398 | 80.31 | ||
| KOG0389|consensus | 941 | 80.11 |
| >KOG1034|consensus | Back alignment and domain information |
|---|
Probab=99.97 E-value=3.6e-30 Score=192.41 Aligned_cols=87 Identities=57% Similarity=1.075 Sum_probs=85.0
Q ss_pred cccccCCCCeEEEEEecCCCCCCCCEEEEeCCCeEEEEEcCCCCCeeEEEEEEcCCCCCceeEEEEeecCCCCceEEEEe
Q psy8253 2 SHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVA 81 (88)
Q Consensus 2 ~~~e~h~~~~y~v~Fnp~~~~~~~~~fAtvG~~~v~Vy~~~~~~~~~~l~~~~d~d~~e~~y~~aWs~d~~~~~plLa~a 81 (88)
+++|+|+.+||||+||+|...++.++|||+|++|++||+|+-++.+.+||+|.|+|++|+||||||++|..+++|+||+|
T Consensus 32 ~l~ed~~~~I~gv~fN~~~~~~e~~vfatvG~~rvtiy~c~~d~~ir~lq~y~D~d~~Esfytcsw~yd~~~~~p~la~~ 111 (385)
T KOG1034|consen 32 HLKEDHNKPIFGVAFNSFLGCDEPQVFATVGGNRVTIYECPGDGGIRLLQSYADEDHDESFYTCSWSYDSNTGNPFLAAG 111 (385)
T ss_pred ehhccCCCccceeeeehhcCCCCCceEEEeCCcEEEEEEECCccceeeeeeccCCCCCcceEEEEEEecCCCCCeeEEee
Confidence 78999999999999999999999999999999999999999999999999999999999999999999988899999999
Q ss_pred cCCcEeC
Q psy8253 82 GSRAVIR 88 (88)
Q Consensus 82 G~~G~Ir 88 (88)
|.+|+||
T Consensus 112 G~~GvIr 118 (385)
T KOG1034|consen 112 GYLGVIR 118 (385)
T ss_pred cceeEEE
Confidence 9999997
|
|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0296|consensus | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >PTZ00421 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >KOG2445|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0277|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >PTZ00420 coronin; Provisional | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG0264|consensus | Back alignment and domain information |
|---|
| >KOG0322|consensus | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0310|consensus | Back alignment and domain information |
|---|
| >KOG2110|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG0266|consensus | Back alignment and domain information |
|---|
| >KOG0303|consensus | Back alignment and domain information |
|---|
| >PLN00181 protein SPA1-RELATED; Provisional | Back alignment and domain information |
|---|
| >KOG0318|consensus | Back alignment and domain information |
|---|
| >KOG0263|consensus | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >KOG0319|consensus | Back alignment and domain information |
|---|
| >KOG2394|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG0273|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG0272|consensus | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >KOG0271|consensus | Back alignment and domain information |
|---|
| >KOG1310|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG0645|consensus | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG1273|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG1009|consensus | Back alignment and domain information |
|---|
| >KOG0276|consensus | Back alignment and domain information |
|---|
| >PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins | Back alignment and domain information |
|---|
| >KOG0315|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG1332|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG0293|consensus | Back alignment and domain information |
|---|
| >KOG0301|consensus | Back alignment and domain information |
|---|
| >KOG1274|consensus | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >KOG0284|consensus | Back alignment and domain information |
|---|
| >KOG0641|consensus | Back alignment and domain information |
|---|
| >KOG0279|consensus | Back alignment and domain information |
|---|
| >KOG0290|consensus | Back alignment and domain information |
|---|
| >KOG0647|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >KOG4378|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG0305|consensus | Back alignment and domain information |
|---|
| >KOG1524|consensus | Back alignment and domain information |
|---|
| >KOG0268|consensus | Back alignment and domain information |
|---|
| >smart00320 WD40 WD40 repeats | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG1587|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG0269|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG4328|consensus | Back alignment and domain information |
|---|
| >PF15390 DUF4613: Domain of unknown function (DUF4613) | Back alignment and domain information |
|---|
| >KOG1645|consensus | Back alignment and domain information |
|---|
| >COG2319 FOG: WD40 repeat [General function prediction only] | Back alignment and domain information |
|---|
| >PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG1445|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG0973|consensus | Back alignment and domain information |
|---|
| >TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG0288|consensus | Back alignment and domain information |
|---|
| >KOG0270|consensus | Back alignment and domain information |
|---|
| >KOG0772|consensus | Back alignment and domain information |
|---|
| >PF14157 YmzC: YmzC-like protein; PDB: 3KVP_E | Back alignment and domain information |
|---|
| >KOG1539|consensus | Back alignment and domain information |
|---|
| >KOG1007|consensus | Back alignment and domain information |
|---|
| >KOG2106|consensus | Back alignment and domain information |
|---|
| >KOG2048|consensus | Back alignment and domain information |
|---|
| >KOG0302|consensus | Back alignment and domain information |
|---|
| >KOG0282|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG1063|consensus | Back alignment and domain information |
|---|
| >KOG0286|consensus | Back alignment and domain information |
|---|
| >KOG4283|consensus | Back alignment and domain information |
|---|
| >KOG0307|consensus | Back alignment and domain information |
|---|
| >KOG0295|consensus | Back alignment and domain information |
|---|
| >KOG2111|consensus | Back alignment and domain information |
|---|
| >KOG0313|consensus | Back alignment and domain information |
|---|
| >KOG1407|consensus | Back alignment and domain information |
|---|
| >KOG4532|consensus | Back alignment and domain information |
|---|
| >KOG1523|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG2055|consensus | Back alignment and domain information |
|---|
| >KOG0640|consensus | Back alignment and domain information |
|---|
| >KOG0291|consensus | Back alignment and domain information |
|---|
| >KOG1538|consensus | Back alignment and domain information |
|---|
| >KOG0316|consensus | Back alignment and domain information |
|---|
| >KOG0265|consensus | Back alignment and domain information |
|---|
| >KOG0649|consensus | Back alignment and domain information |
|---|
| >KOG1036|consensus | Back alignment and domain information |
|---|
| >KOG0285|consensus | Back alignment and domain information |
|---|
| >KOG0283|consensus | Back alignment and domain information |
|---|
| >KOG0308|consensus | Back alignment and domain information |
|---|
| >KOG1034|consensus | Back alignment and domain information |
|---|
| >KOG0771|consensus | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 88 | ||||
| 3iiy_A | 365 | Crystal Structure Of Eed In Complex With A Trimethy | 4e-28 | ||
| 3jzn_A | 366 | Structure Of Eed In Apo Form Length = 366 | 4e-28 | ||
| 3iiw_A | 365 | Crystal Structure Of Eed In Complex With A Trimethy | 4e-28 | ||
| 2qxv_A | 361 | Structural Basis Of Ezh2 Recognition By Eed Length | 4e-28 | ||
| 3jpx_A | 402 | Eed: A Novel Histone Trimethyllysine Binder Within | 5e-28 |
| >pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 | Back alignment and structure |
|
| >pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 | Back alignment and structure |
| >pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 | Back alignment and structure |
| >pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 | Back alignment and structure |
| >pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 88 | |||
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 7e-22 |
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Length = 366 | Back alignment and structure |
|---|
Score = 85.8 bits (213), Expect = 7e-22
Identities = 54/85 (63%), Positives = 63/85 (74%)
Query: 4 KEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFY 63
KEDH QPLFG QFN K+ P +FATVGSNRV++YEC G I+LLQ Y D D +ENFY
Sbjct: 14 KEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFY 73
Query: 64 TCAWSMDLESGRPLLAVAGSRAVIR 88
TCAW+ D + PLLAVAGSR +IR
Sbjct: 74 TCAWTYDSNTSHPLLAVAGSRGIIR 98
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 99.31 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 98.4 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 98.35 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 98.34 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 98.34 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 98.3 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 98.26 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 98.25 | |
| 2pm7_B | 297 | Protein transport protein SEC13, protein transport | 98.2 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 98.2 | |
| 2hes_X | 330 | YDR267CP; beta-propeller, WD40 repeat, biosyntheti | 98.19 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 98.17 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 98.17 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 98.16 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 98.14 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 98.13 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 98.11 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 98.11 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 98.1 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 98.1 | |
| 3bg1_A | 316 | Protein SEC13 homolog; NPC, transport, WD repeat, | 98.1 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 98.08 | |
| 3fm0_A | 345 | Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r | 98.07 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 98.06 | |
| 3ow8_A | 321 | WD repeat-containing protein 61; structural genomi | 98.06 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 98.05 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 98.02 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 98.0 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 97.99 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 97.99 | |
| 4gqb_B | 344 | Methylosome protein 50; TIM barrel, beta-propeller | 97.97 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.96 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 97.95 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.94 | |
| 1sq9_A | 397 | Antiviral protein SKI8; WD repeat, beta-transducin | 97.93 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 97.92 | |
| 3mmy_A | 368 | MRNA export factor; mRNA export, nuclear protein; | 97.92 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 97.91 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.91 | |
| 3frx_A | 319 | Guanine nucleotide-binding protein subunit beta- l | 97.91 | |
| 2xzm_R | 343 | RACK1; ribosome, translation; 3.93A {Tetrahymena t | 97.9 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 97.9 | |
| 3jrp_A | 379 | Fusion protein of protein transport protein SEC13 | 97.9 | |
| 3f3f_A | 351 | Nucleoporin SEH1; structural protein, protein comp | 97.89 | |
| 1got_B | 340 | GT-beta; complex (GTP-binding/transducer), G prote | 97.89 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 97.89 | |
| 2aq5_A | 402 | Coronin-1A; WD40 repeat, 7-bladed beta-propeller, | 97.86 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 97.85 | |
| 2ynn_A | 304 | Coatomer subunit beta'; protein transport, peptide | 97.85 | |
| 3i2n_A | 357 | WD repeat-containing protein 92; WD40 repeats, str | 97.85 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 97.84 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 97.84 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 97.83 | |
| 4ery_A | 312 | WD repeat-containing protein 5; WD40, WIN motif, b | 97.83 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 97.82 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 97.82 | |
| 1k8k_C | 372 | P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- | 97.81 | |
| 3dw8_B | 447 | Serine/threonine-protein phosphatase 2A 55 kDa RE | 97.81 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 97.8 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 97.79 | |
| 3k26_A | 366 | Polycomb protein EED; WD40, structural genomics, N | 97.78 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 97.78 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.78 | |
| 3iz6_a | 380 | 40S ribosomal protein RACK1 (RACK1); eukaryotic ri | 97.76 | |
| 2pbi_B | 354 | Guanine nucleotide-binding protein subunit beta 5; | 97.75 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 97.74 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 97.74 | |
| 4ggc_A | 318 | P55CDC, cell division cycle protein 20 homolog; ce | 97.73 | |
| 1nr0_A | 611 | Actin interacting protein 1; beta propeller, WD40 | 97.73 | |
| 4g56_B | 357 | MGC81050 protein; protein arginine methyltransfera | 97.72 | |
| 4e54_B | 435 | DNA damage-binding protein 2; beta barrel, double | 97.71 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 97.71 | |
| 1gxr_A | 337 | ESG1, transducin-like enhancer protein 1; transcri | 97.7 | |
| 3dwl_C | 377 | Actin-related protein 2/3 complex subunit 1; prope | 97.7 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 97.68 | |
| 1vyh_C | 410 | Platelet-activating factor acetylhydrolase IB alph | 97.68 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 97.66 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.63 | |
| 4aow_A | 340 | Guanine nucleotide-binding protein subunit beta-2; | 97.61 | |
| 2ymu_A | 577 | WD-40 repeat protein; unknown function, two domain | 97.61 | |
| 3dm0_A | 694 | Maltose-binding periplasmic protein fused with RAC | 97.58 | |
| 3gre_A | 437 | Serine/threonine-protein kinase VPS15; seven-blade | 97.57 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.57 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 97.57 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 97.57 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 97.55 | |
| 2xyi_A | 430 | Probable histone-binding protein CAF1; transcripti | 97.55 | |
| 3ei3_B | 383 | DNA damage-binding protein 2; UV-damage, DDB, nucl | 97.55 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 97.52 | |
| 4aez_A | 401 | CDC20, WD repeat-containing protein SLP1; cell cyc | 97.49 | |
| 3lrv_A | 343 | PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu | 97.45 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 97.44 | |
| 2pm9_A | 416 | Protein WEB1, protein transport protein SEC31; bet | 97.43 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 97.43 | |
| 1erj_A | 393 | Transcriptional repressor TUP1; beta-propeller, tr | 97.43 | |
| 4a11_B | 408 | DNA excision repair protein ERCC-8; DNA binding pr | 97.42 | |
| 1pgu_A | 615 | Actin interacting protein 1; WD repeat, seven-blad | 97.42 | |
| 4gga_A | 420 | P55CDC, cell division cycle protein 20 homolog; ce | 97.41 | |
| 3mkq_A | 814 | Coatomer beta'-subunit; beta-propeller, alpha-sole | 97.4 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 97.4 | |
| 3jro_A | 753 | Fusion protein of protein transport protein SEC13 | 97.38 | |
| 3zwl_B | 369 | Eukaryotic translation initiation factor 3 subuni; | 97.37 | |
| 3sfz_A | 1249 | APAF-1, apoptotic peptidase activating factor 1; a | 97.34 | |
| 2vdu_B | 450 | TRNA (guanine-N(7)-)-methyltransferase- associated | 97.34 | |
| 3odt_A | 313 | Protein DOA1; ubiquitin, nuclear protein; HET: MSE | 97.32 | |
| 4h5i_A | 365 | Guanine nucleotide-exchange factor SEC12; copii ve | 97.26 | |
| 1r5m_A | 425 | SIR4-interacting protein SIF2; transcription corep | 97.24 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.22 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 97.13 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 97.09 | |
| 2oaj_A | 902 | Protein SNI1; WD40 repeat, beta propeller, endocyt | 97.08 | |
| 3vl1_A | 420 | 26S proteasome regulatory subunit RPN14; beta-prop | 97.07 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.0 | |
| 2j04_B | 524 | YDR362CP, TAU91; beta propeller, type 2 promoters, | 97.0 | |
| 2oit_A | 434 | Nucleoporin 214KDA; NH2 terminal domain of NUP214/ | 96.86 | |
| 1yfq_A | 342 | Cell cycle arrest protein BUB3; WD repeat WD40 rep | 96.72 | |
| 3vu4_A | 355 | KMHSV2; beta-propeller fold, protein transport; 2. | 96.72 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 96.52 | |
| 2j04_A | 588 | TAU60, YPL007P, hypothetical protein YPL007C; beta | 96.43 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 96.4 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 96.39 | |
| 1l0q_A | 391 | Surface layer protein; SLP, S-layer, 7-bladed beta | 96.36 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 96.23 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 96.08 | |
| 4gq1_A | 393 | NUP37; propeller, transport protein; 2.40A {Schizo | 95.92 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 95.9 | |
| 3bws_A | 433 | Protein LP49; two-domain, immunoglobulin-like, 7-b | 95.75 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 95.5 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 95.39 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 95.31 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 95.25 | |
| 1ri6_A | 343 | Putative isomerase YBHE; 7-bladed propeller, enzym | 95.18 | |
| 1jof_A | 365 | Carboxy-CIS,CIS-muconate cyclase; beta-propeller, | 95.1 | |
| 3hfq_A | 347 | Uncharacterized protein LP_2219; Q88V64_lacpl, NES | 94.94 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 94.84 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 94.32 | |
| 2w18_A | 356 | PALB2, fancn, partner and localizer of BRCA2; fanc | 94.25 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 93.98 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 93.2 | |
| 3u4y_A | 331 | Uncharacterized protein; structural genomics, PSI- | 93.04 | |
| 2ojh_A | 297 | Uncharacterized protein ATU1656/AGR_C_3050; TOLB, | 92.24 | |
| 3scy_A | 361 | Hypothetical bacterial 6-phosphogluconolactonase; | 91.01 | |
| 3kvp_A | 72 | Uncharacterized protein YMZC; structural genomics, | 90.91 | |
| 2hqs_A | 415 | Protein TOLB; TOLB, PAL, TOL, transport protein-li | 90.73 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 90.63 | |
| 3vgz_A | 353 | Uncharacterized protein YNCE; beta-propeller, prot | 89.34 | |
| 1xip_A | 388 | Nucleoporin NUP159; beta-propeller, transport prot | 89.21 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 88.28 | |
| 1jmx_B | 349 | Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; | 88.22 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 87.69 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 87.22 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 86.31 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 84.69 | |
| 1pby_B | 337 | Quinohemoprotein amine dehydrogenase 40 kDa subuni | 84.29 | |
| 2mad_H | 373 | Methylamine dehydrogenase (heavy subunit); oxidore | 83.25 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 83.01 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 82.49 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 81.65 | |
| 1k32_A | 1045 | Tricorn protease; protein degradation, substrate g | 81.04 | |
| 1nir_A | 543 | Nitrite reductase; hemoprotein, denitrification, d | 80.31 |
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
Probab=99.31 E-value=2.6e-11 Score=83.86 Aligned_cols=87 Identities=63% Similarity=1.092 Sum_probs=76.4
Q ss_pred cccccCCCCeEEEEEecCCCCCCCCEEEEeCCCeEEEEEcCCCCCeeEEEEEEcCCCCCceeEEEEeecCCCCceEEEEe
Q psy8253 2 SHKEDHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVA 81 (88)
Q Consensus 2 ~~~e~h~~~~y~v~Fnp~~~~~~~~~fAtvG~~~v~Vy~~~~~~~~~~l~~~~d~d~~e~~y~~aWs~d~~~~~plLa~a 81 (88)
.+++.|..+|++++|+|..+.+...++|+.+.+.|.||++..++.+..++.+.++.+++.+++++|+.+...+..+|++|
T Consensus 12 ~~~~~h~~~v~~i~~~p~~~~~~~~~~~~~~~~~v~vw~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~l~~~ 91 (366)
T 3k26_A 12 SLKEDHNQPLFGVQFNWHSKEGDPLVFATVGSNRVTLYECHSQGEIRLLQSYVDADADENFYTCAWTYDSNTSHPLLAVA 91 (366)
T ss_dssp EEECTTCSCEEEEEECTTCCTTSCEEEEEEETTEEEEEEECGGGCEEEEEEEECSCTTCCEEEEEEEECTTTCCEEEEEE
T ss_pred EeecCCCCceEEEEEecccCCCCceEEEECCCCEEEEEEcCCCcEEEeeeeccccCCCCcEEEEEeccCCCCCCCEEEEe
Confidence 46778999999999999865566789999999999999999887889999998888899999999999965546789999
Q ss_pred cCCcEeC
Q psy8253 82 GSRAVIR 88 (88)
Q Consensus 82 G~~G~Ir 88 (88)
+.+|.|+
T Consensus 92 ~~dg~i~ 98 (366)
T 3k26_A 92 GSRGIIR 98 (366)
T ss_dssp ETTCEEE
T ss_pred cCCCEEE
Confidence 9999885
|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* | Back alignment and structure |
|---|
| >2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A | Back alignment and structure |
|---|
| >1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A | Back alignment and structure |
|---|
| >3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C | Back alignment and structure |
|---|
| >3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} | Back alignment and structure |
|---|
| >2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A | Back alignment and structure |
|---|
| >4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} | Back alignment and structure |
|---|
| >4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A | Back alignment and structure |
|---|
| >3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a | Back alignment and structure |
|---|
| >2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} | Back alignment and structure |
|---|
| >3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B | Back alignment and structure |
|---|
| >3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 | Back alignment and structure |
|---|
| >4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A | Back alignment and structure |
|---|
| >4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A | Back alignment and structure |
|---|
| >3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* | Back alignment and structure |
|---|
| >2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A | Back alignment and structure |
|---|
| >1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A | Back alignment and structure |
|---|
| >1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A | Back alignment and structure |
|---|
| >3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 | Back alignment and structure |
|---|
| >1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 | Back alignment and structure |
|---|
| >3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} | Back alignment and structure |
|---|
| >2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A | Back alignment and structure |
|---|
| >3kvp_A Uncharacterized protein YMZC; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.40A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* | Back alignment and structure |
|---|
| >1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* | Back alignment and structure |
|---|
| >2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* | Back alignment and structure |
|---|
| >1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 88 | |||
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.63 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 98.58 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 98.39 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 98.32 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 98.29 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 98.23 | |
| d1gxra_ | 337 | Groucho/tle1, C-terminal domain {Human (Homo sapie | 98.18 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 98.1 | |
| d1tbga_ | 340 | beta1-subunit of the signal-transducing G protein | 98.1 | |
| d1k8kc_ | 371 | Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur | 98.06 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 98.0 | |
| d1vyhc1 | 317 | Platelet-activating factor acetylhydrolase IB subu | 97.9 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.83 | |
| d1nr0a1 | 311 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.73 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.66 | |
| d1nr0a2 | 299 | Actin interacting protein 1 {Nematode (Caenorhabdi | 97.65 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.59 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 97.54 | |
| d1erja_ | 388 | Tup1, C-terminal domain {Baker's yeast (Saccharomy | 97.53 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.53 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 97.51 | |
| d1pgua1 | 325 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.41 | |
| d2ovrb2 | 342 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 97.37 | |
| d1pgua2 | 287 | Actin interacting protein 1 {Baker's yeast (Saccha | 97.33 | |
| d1yfqa_ | 342 | Cell cycle arrest protein BUB3 {Baker's yeast (Sac | 97.15 | |
| d1nexb2 | 355 | Cdc4 propeller domain {Baker's yeast (Saccharomyce | 97.12 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 97.08 | |
| d1sq9a_ | 393 | Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac | 97.05 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 96.79 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 96.56 | |
| d1k32a3 | 360 | Tricorn protease domain 2 {Archaeon Thermoplasma a | 96.38 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 96.19 | |
| d1ri6a_ | 333 | Putative isomerase YbhE {Escherichia coli [TaxId: | 96.16 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 96.06 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 95.3 | |
| d1jmxb_ | 346 | Quinohemoprotein amine dehydrogenase B chain {Pseu | 95.2 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 94.78 | |
| d1pbyb_ | 337 | Quinohemoprotein amine dehydrogenase B chain {Para | 94.55 | |
| d1l0qa2 | 301 | Surface layer protein {Archaeon Methanosarcina maz | 93.81 | |
| d1hzua2 | 426 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 90.1 | |
| d2madh_ | 373 | Methylamine dehydrogenase, H-chain {Gram negative | 89.28 | |
| d1p22a2 | 293 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 88.21 | |
| d2bbkh_ | 355 | Methylamine dehydrogenase, H-chain {Paracoccus den | 87.46 | |
| d1qksa2 | 432 | C-terminal (heme d1) domain of cytochrome cd1-nitr | 86.43 |
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: 7-bladed beta-propeller superfamily: WD40 repeat-like family: WD40-repeat domain: Groucho/tle1, C-terminal domain species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.63 E-value=7.9e-08 Score=65.41 Aligned_cols=74 Identities=16% Similarity=0.259 Sum_probs=60.7
Q ss_pred cCCCCeEEEEEecCCCCCCCCEEEEeCCCeEEEEEcCCCCCeeEEEEEEcCCCCCceeEEEEeecCCCCceEEEEecCCc
Q psy8253 6 DHGQPLFGAQFNHLLKDDQPRIFATVGSNRVSIYECPDGGSIKLLQCYADPDIEENFYTCAWSMDLESGRPLLAVAGSRA 85 (88)
Q Consensus 6 ~h~~~~y~v~Fnp~~~~~~~~~fAtvG~~~v~Vy~~~~~~~~~~l~~~~d~d~~e~~y~~aWs~d~~~~~plLa~aG~~G 85 (88)
.|..++.+++|+| ..+.+||.|.+.|.|+++...+....+.......++..+.+++|+.+ ..+|++|+.+|
T Consensus 49 ~H~~~V~~v~fs~-----~g~~latg~dg~V~iWd~~~~~~~~~~~~~~~~~h~~~I~~v~~s~d----g~~l~s~~~dg 119 (337)
T d1gxra_ 49 NHGEVVCAVTISN-----PTRHVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCKLLPD----GCTLIVGGEAS 119 (337)
T ss_dssp CCSSCCCEEEECS-----SSSEEEEECBSEEEEEETTSTTCCSCSEEEECSCTTSBEEEEEECTT----SSEEEEEESSS
T ss_pred CCCCcEEEEEECC-----CCCEEEEEECCEEEEEEccCCcccceeEEeeecCCCCcEEEEEEcCC----CCEEEEeeccc
Confidence 6889999999987 35779999988999999988766556666655567888999999976 34699999999
Q ss_pred EeC
Q psy8253 86 VIR 88 (88)
Q Consensus 86 ~Ir 88 (88)
.|+
T Consensus 120 ~i~ 122 (337)
T d1gxra_ 120 TLS 122 (337)
T ss_dssp EEE
T ss_pred ccc
Confidence 885
|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} | Back information, alignment and structure |
|---|
| >d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|