Diaphorina citri psyllid: psy8266


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------
MISLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
cccccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
*************************NAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Aryl hydrocarbon receptor Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues.confidentP35869
Aryl hydrocarbon receptor Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues.confidentP41738
Aryl hydrocarbon receptor Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues.confidentP30561

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityconfidentGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0008150 [BP]biological_processconfident
GO:0033235 [BP]positive regulation of protein sumoylationprobableGO:0032268, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0031325, GO:0031401, GO:0031323, GO:0051247, GO:0050794, GO:0008150, GO:0048518, GO:0032270, GO:0031399, GO:0033233, GO:0065007, GO:0019222, GO:0010604, GO:0050789, GO:0048522
GO:0048814 [BP]regulation of dendrite morphogenesisprobableGO:0022604, GO:0044707, GO:0010975, GO:0022603, GO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0007275, GO:0048731
GO:0043565 [MF]sequence-specific DNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0046982 [MF]protein heterodimerization activityprobableGO:0046983, GO:0003674, GO:0005488, GO:0005515
GO:0010092 [BP]specification of organ identityprobableGO:0032502, GO:0007389, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0048646, GO:0044767, GO:0048513, GO:0008150, GO:0003002, GO:0007275, GO:0048731, GO:0009653, GO:0048645, GO:0044699
GO:0048800 [BP]antennal morphogenesisprobableGO:0048563, GO:0048569, GO:0035107, GO:0009887, GO:0009791, GO:0002165, GO:0035214, GO:0009653, GO:0007275, GO:0044699, GO:0007455, GO:0007552, GO:0048513, GO:0032502, GO:0048707, GO:0009886, GO:0032501, GO:0035114, GO:0008150, GO:0007469, GO:0044767, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0045899 [BP]positive regulation of RNA polymerase II transcriptional preinitiation complex assemblyprobableGO:0060260, GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:0051173, GO:0031323, GO:0051128, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0044087, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:2000142, GO:0065007, GO:0048518, GO:0010468, GO:0051130, GO:0045935, GO:0010556, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:2001141, GO:0043254, GO:0045898, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0045944, GO:0048522
GO:0036011 [BP]imaginal disc-derived leg segmentationprobableGO:0048563, GO:0035108, GO:0048569, GO:0060173, GO:0035107, GO:0009887, GO:0009791, GO:0035120, GO:0002165, GO:0032501, GO:0035127, GO:0035282, GO:0009653, GO:0035285, GO:0044699, GO:0007389, GO:0007478, GO:0007552, GO:0007275, GO:0048513, GO:0048646, GO:0032502, GO:0048707, GO:0009886, GO:0007480, GO:0035218, GO:0044767, GO:0008150, GO:0003002, GO:0035114, GO:0044707, GO:0007444, GO:0048856, GO:0007560, GO:0048731, GO:0048736, GO:0048737
GO:0030850 [BP]prostate gland developmentprobableGO:0032502, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0044212 [MF]transcription regulatory region DNA bindingprobableGO:0097159, GO:0000975, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0051879 [MF]Hsp90 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515
GO:0030888 [BP]regulation of B cell proliferationprobableGO:0042127, GO:0051249, GO:0050865, GO:0050864, GO:0050670, GO:0050794, GO:0008150, GO:0002694, GO:0070663, GO:0002682, GO:0032944, GO:0065007, GO:0050789
GO:0009636 [BP]response to toxic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0006805 [BP]xenobiotic metabolic processprobableGO:0051716, GO:0008152, GO:0050896, GO:0009987, GO:0044763, GO:0009410, GO:0044237, GO:0071466, GO:0008150, GO:0070887, GO:0042221, GO:0044699
GO:0007049 [BP]cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0008134 [MF]transcription factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048511 [BP]rhythmic processprobableGO:0008150
GO:0071320 [BP]cellular response to cAMPprobableGO:0070887, GO:0014074, GO:0044699, GO:0009719, GO:0051716, GO:1901698, GO:0071417, GO:0071310, GO:0014070, GO:0046683, GO:0071495, GO:0009987, GO:0051591, GO:0044763, GO:0042221, GO:0010033, GO:1901700, GO:1901701, GO:0071407, GO:0010243, GO:1901699, GO:0008150, GO:0050896
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0004879 [MF]ligand-activated sequence-specific DNA binding RNA polymerase II transcription factor activityprobableGO:0038023, GO:0003700, GO:0060089, GO:0003674, GO:0004872, GO:0004871, GO:0000981, GO:0001071
GO:0030522 [BP]intracellular receptor mediated signaling pathwayprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4F3L, chain B
Confidence level:very confident
Coverage over the Query: 14-63
View the alignment between query and template
View the model in PyMOL