Psyllid ID: psy8266


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------
MISLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
ccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHc
ccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc
mislkpppkdgvtksnpskrHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
mislkpppkdgvtksnpskrhRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
MISLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
****************************LDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSY****
*************************NAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
*******************RHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
********************HRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQE*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQEM
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query68 2.2.26 [Sep-21-2011]
P41738 853 Aryl hydrocarbon receptor yes N/A 0.911 0.072 0.682 1e-18
Q8R4S5 883 Aryl hydrocarbon receptor N/A N/A 0.911 0.070 0.682 1e-18
Q8R4S4 854 Aryl hydrocarbon receptor N/A N/A 0.911 0.072 0.682 1e-18
Q8R4S6 848 Aryl hydrocarbon receptor N/A N/A 0.911 0.073 0.682 2e-18
Q8R4S2 854 Aryl hydrocarbon receptor N/A N/A 0.911 0.072 0.682 2e-18
P30561 848 Aryl hydrocarbon receptor yes N/A 0.911 0.073 0.682 2e-18
Q8R4S7 854 Aryl hydrocarbon receptor N/A N/A 0.911 0.072 0.682 2e-18
P35869 848 Aryl hydrocarbon receptor yes N/A 0.911 0.073 0.682 2e-18
Q95LD9 845 Aryl hydrocarbon receptor N/A N/A 0.911 0.073 0.682 2e-18
O02747 847 Aryl hydrocarbon receptor yes N/A 0.911 0.073 0.682 2e-18
>sp|P41738|AHR_RAT Aryl hydrocarbon receptor OS=Rattus norvegicus GN=Ahr PE=1 SV=2 Back     alignment and function desciption
 Score = 91.7 bits (226), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 56/63 (88%), Gaps = 1/63 (1%)

Query: 3  SLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTK 62
          ++KP P +G+ KSNPSKRHR+RLN ELD LA+LLPF Q++++KLD+LS+LRLSVSYLR K
Sbjct: 21 TVKPVPAEGI-KSNPSKRHRDRLNTELDRLASLLPFPQDVINKLDKLSVLRLSVSYLRAK 79

Query: 63 SYF 65
          S+F
Sbjct: 80 SFF 82




Ligand-activated transcriptional activator. Binds to the XRE promoter region of genes it activates. Activates the expression of multiple phase I and II xenobiotic chemical metabolizing enzyme genes (such as the CYP1A1 gene). Mediates biochemical and toxic effects of halogenated aromatic hydrocarbons. Involved in cell-cycle regulation. Likely to play an important role in the development and maturation of many tissues.
Rattus norvegicus (taxid: 10116)
>sp|Q8R4S5|AHR_MUSMM Aryl hydrocarbon receptor OS=Mus musculus molossinus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|Q8R4S4|AHR_MUSSI Aryl hydrocarbon receptor OS=Mus spicilegus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|Q8R4S6|AHR_MUSMC Aryl hydrocarbon receptor OS=Mus musculus castaneus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|Q8R4S2|AHR_MUSSP Aryl hydrocarbon receptor OS=Mus spretus GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|P30561|AHR_MOUSE Aryl hydrocarbon receptor OS=Mus musculus GN=Ahr PE=1 SV=3 Back     alignment and function description
>sp|Q8R4S7|AHR_MUSCR Aryl hydrocarbon receptor OS=Mus caroli GN=Ahr PE=2 SV=1 Back     alignment and function description
>sp|P35869|AHR_HUMAN Aryl hydrocarbon receptor OS=Homo sapiens GN=AHR PE=1 SV=2 Back     alignment and function description
>sp|Q95LD9|AHR_DELLE Aryl hydrocarbon receptor OS=Delphinapterus leucas GN=AHR PE=2 SV=1 Back     alignment and function description
>sp|O02747|AHR_RABIT Aryl hydrocarbon receptor OS=Oryctolagus cuniculus GN=AHR PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
195500996 1062 GE26316 [Drosophila yakuba] gi|194183713 0.941 0.060 0.968 2e-27
195107625 1064 GI23647 [Drosophila mojavensis] gi|19391 0.941 0.060 0.968 2e-27
194901278 1057 GG19993 [Drosophila erecta] gi|190651882 0.941 0.060 0.968 2e-27
195152766 1100 GL22243 [Drosophila persimilis] gi|19411 0.941 0.058 0.968 2e-27
386765904 1015 spineless, isoform C [Drosophila melanog 0.941 0.063 0.968 2e-27
195037953 1082 GH18248 [Drosophila grimshawi] gi|193894 0.941 0.059 0.968 2e-27
195389004 1099 GJ23490 [Drosophila virilis] gi|19415125 0.941 0.058 0.968 2e-27
195451109 1031 GK13504 [Drosophila willistoni] gi|19416 0.941 0.062 0.968 2e-27
390178920 878 GA20013, isoform B [Drosophila pseudoobs 0.955 0.074 0.953 2e-27
3132524 884 Ahr homolog spineless [Drosophila melano 0.941 0.072 0.968 2e-27
>gi|195500996|ref|XP_002097612.1| GE26316 [Drosophila yakuba] gi|194183713|gb|EDW97324.1| GE26316 [Drosophila yakuba] Back     alignment and taxonomy information
 Score =  126 bits (316), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 62/64 (96%), Positives = 63/64 (98%)

Query: 3  SLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTK 62
          SLKPPPKDGVTKSNPSKRHRERLNAELD LA+LLPFEQNILSKLDRLSILRLSVSYLRTK
Sbjct: 19 SLKPPPKDGVTKSNPSKRHRERLNAELDLLASLLPFEQNILSKLDRLSILRLSVSYLRTK 78

Query: 63 SYFQ 66
          SYFQ
Sbjct: 79 SYFQ 82




Source: Drosophila yakuba

Species: Drosophila yakuba

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195107625|ref|XP_001998409.1| GI23647 [Drosophila mojavensis] gi|193915003|gb|EDW13870.1| GI23647 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|194901278|ref|XP_001980179.1| GG19993 [Drosophila erecta] gi|190651882|gb|EDV49137.1| GG19993 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195152766|ref|XP_002017307.1| GL22243 [Drosophila persimilis] gi|194112364|gb|EDW34407.1| GL22243 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|386765904|ref|NP_001247140.1| spineless, isoform C [Drosophila melanogaster] gi|386765906|ref|NP_001163629.2| spineless, isoform D [Drosophila melanogaster] gi|383292749|gb|AFH06458.1| spineless, isoform C [Drosophila melanogaster] gi|383292750|gb|ACZ94925.2| spineless, isoform D [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195037953|ref|XP_001990425.1| GH18248 [Drosophila grimshawi] gi|193894621|gb|EDV93487.1| GH18248 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195389004|ref|XP_002053168.1| GJ23490 [Drosophila virilis] gi|194151254|gb|EDW66688.1| GJ23490 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195451109|ref|XP_002072771.1| GK13504 [Drosophila willistoni] gi|194168856|gb|EDW83757.1| GK13504 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|390178920|ref|XP_001359453.3| GA20013, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859639|gb|EAL28599.3| GA20013, isoform B [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|3132524|gb|AAD09205.1| Ahr homolog spineless [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query68
FB|FBgn0003513 1048 ss "spineless" [Drosophila mel 0.941 0.061 0.968 2e-26
UNIPROTKB|F1SEI6 385 F1SEI6 "Uncharacterized protei 0.941 0.166 0.661 8.9e-19
UNIPROTKB|E5RFG4157 AHRR "Aryl hydrocarbon recepto 0.911 0.394 0.725 1.4e-18
UNIPROTKB|E5RGQ281 AHRR "Aryl hydrocarbon recepto 0.911 0.765 0.725 1.4e-18
UNIPROTKB|G3V143139 AHRR "Aryl hydrocarbon recepto 0.911 0.446 0.725 1.4e-18
UNIPROTKB|I3L5U3 394 I3L5U3 "Uncharacterized protei 0.911 0.157 0.682 1.7e-18
UNIPROTKB|F1NLX8 839 AHR "Uncharacterized protein" 0.897 0.072 0.725 2.4e-18
UNIPROTKB|G3V6M2 853 Ahr "RCG61977, isoform CRA_b" 0.911 0.072 0.698 4e-18
RGD|2074 853 Ahr "aryl hydrocarbon receptor 0.911 0.072 0.682 8.3e-18
UNIPROTKB|P35869 848 AHR "Aryl hydrocarbon receptor 0.911 0.073 0.682 1.1e-17
FB|FBgn0003513 ss "spineless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 310 (114.2 bits), Expect = 2.0e-26, P = 2.0e-26
 Identities = 62/64 (96%), Positives = 63/64 (98%)

Query:     3 SLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTK 62
             SLKPPPKDGVTKSNPSKRHRERLNAELD LA+LLPFEQNILSKLDRLSILRLSVSYLRTK
Sbjct:    19 SLKPPPKDGVTKSNPSKRHRERLNAELDLLASLLPFEQNILSKLDRLSILRLSVSYLRTK 78

Query:    63 SYFQ 66
             SYFQ
Sbjct:    79 SYFQ 82




GO:0005634 "nucleus" evidence=ISS;IDA;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0003677 "DNA binding" evidence=ISS
GO:0006366 "transcription from RNA polymerase II promoter" evidence=NAS
GO:0007469 "antennal development" evidence=IEP
GO:0048800 "antennal morphogenesis" evidence=IMP
GO:0004871 "signal transducer activity" evidence=IEA
GO:0007165 "signal transduction" evidence=IEA
GO:0010092 "specification of organ identity" evidence=IMP
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0046982 "protein heterodimerization activity" evidence=IPI
GO:0036011 "imaginal disc-derived leg segmentation" evidence=IMP
GO:0003705 "RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity" evidence=IDA
GO:0048814 "regulation of dendrite morphogenesis" evidence=IMP
UNIPROTKB|F1SEI6 F1SEI6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E5RFG4 AHRR "Aryl hydrocarbon receptor repressor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5RGQ2 AHRR "Aryl hydrocarbon receptor repressor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|G3V143 AHRR "Aryl hydrocarbon receptor repressor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L5U3 I3L5U3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NLX8 AHR "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6M2 Ahr "RCG61977, isoform CRA_b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2074 Ahr "aryl hydrocarbon receptor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P35869 AHR "Aryl hydrocarbon receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35869AHR_HUMANNo assigned EC number0.68250.91170.0731yesN/A
P30561AHR_MOUSENo assigned EC number0.68250.91170.0731yesN/A
O44712AHR_CAEELNo assigned EC number0.57140.91170.1029yesN/A
O02747AHR_RABITNo assigned EC number0.68250.91170.0731yesN/A
P41738AHR_RATNo assigned EC number0.68250.91170.0726yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
smart0035353 smart00353, HLH, helix loop helix domain 1e-05
cd0008360 cd00083, HLH, Helix-loop-helix domain, found in sp 1e-05
pfam0001052 pfam00010, HLH, Helix-loop-helix DNA-binding domai 8e-04
>gnl|CDD|197674 smart00353, HLH, helix loop helix domain Back     alignment and domain information
 Score = 38.0 bits (89), Expect = 1e-05
 Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 19 KRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLR 60
          +R R ++N   D L +LLP       KL +  ILRL++ Y++
Sbjct: 5  RRRRRKINEAFDELRSLLPTLPKN-KKLSKAEILRLAIEYIK 45


Length = 53

>gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 68
KOG3558|consensus 768 99.74
KOG3560|consensus 712 99.72
KOG3559|consensus 598 99.47
PF0001055 HLH: Helix-loop-helix DNA-binding domain only nucl 99.34
KOG3561|consensus 803 99.32
cd0008360 HLH Helix-loop-helix domain, found in specific DNA 99.31
smart0035353 HLH helix loop helix domain. 99.3
KOG4304|consensus 250 99.2
KOG1318|consensus 411 98.31
KOG1319|consensus 229 97.4
KOG4029|consensus228 97.37
KOG2483|consensus 232 96.13
KOG0561|consensus 373 96.0
KOG2588|consensus 953 95.93
KOG3960|consensus 284 95.81
PLN0321793 transcription factor ATBS1; Provisional 95.32
>KOG3558|consensus Back     alignment and domain information
Probab=99.74  E-value=1.2e-18  Score=140.49  Aligned_cols=54  Identities=37%  Similarity=0.624  Sum_probs=52.7

Q ss_pred             CCchhHHHhHHHhHHHHHHHHhcCCCCCccccchHHHHHHHHHHHHHHhhhhhh
Q psy8266          13 TKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQ   66 (68)
Q Consensus        13 ~~~~aeK~RRdk~N~~~~~L~~lLP~~~~~~~kLDKaSILrlti~yLk~~~~~~   66 (68)
                      +||+|+|+||.|||++|+||+.+||++++++++||||||||+||+|||+++|+.
T Consensus        49 kSRdAARsRRsKEn~~FyeLa~~lPlp~aisshLDkaSimRLtISyLRlrk~a~  102 (768)
T KOG3558|consen   49 KSRDAARSRRSKENEEFYELAKLLPLPAAISSHLDKASIMRLTISYLRLRKFAG  102 (768)
T ss_pred             hhhhhhhhhcccchHHHHHHHHhCCCcchhhhhhhhHHHHHHHHHHHHHHHHhh
Confidence            799999999999999999999999999999999999999999999999999975



>KOG3560|consensus Back     alignment and domain information
>KOG3559|consensus Back     alignment and domain information
>PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) Back     alignment and domain information
>KOG3561|consensus Back     alignment and domain information
>cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long Back     alignment and domain information
>smart00353 HLH helix loop helix domain Back     alignment and domain information
>KOG4304|consensus Back     alignment and domain information
>KOG1318|consensus Back     alignment and domain information
>KOG1319|consensus Back     alignment and domain information
>KOG4029|consensus Back     alignment and domain information
>KOG2483|consensus Back     alignment and domain information
>KOG0561|consensus Back     alignment and domain information
>KOG2588|consensus Back     alignment and domain information
>KOG3960|consensus Back     alignment and domain information
>PLN03217 transcription factor ATBS1; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
4f3l_B 387 Crystal Structure Of The Heterodimeric Clock:bmal1 1e-04
4h10_A73 Intermolecular Recognition Revealed By The Complex 1e-04
>pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 Back     alignment and structure

Iteration: 1

Score = 41.6 bits (96), Expect = 1e-04, Method: Compositional matrix adjust. Identities = 18/47 (38%), Positives = 34/47 (72%) Query: 15 SNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRT 61 S KR R+++N+ +D LA+L+P + KLD+L++LR++V +++T Sbjct: 18 SQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKT 64
>pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex Structure Of Human Clock-bmal1 Basic Helix-loop-helix Domains With E-box Dna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query68
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 5e-21
4f3l_A 361 Mclock, circadian locomoter output cycles protein 4e-20
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 Back     alignment and structure
 Score = 82.7 bits (204), Expect = 5e-21
 Identities = 18/54 (33%), Positives = 34/54 (62%)

Query: 14 KSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQE 67
           S   KR R+++N+ +D LA+L+P    +  KLD+L++LR++V +++T      
Sbjct: 17 HSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATN 70


>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
4h10_A73 ARYL hydrocarbon receptor nuclear translocator-LI 99.66
4f3l_A 361 Mclock, circadian locomoter output cycles protein 99.56
4f3l_B 387 BMAL1B; BHLH, PAS, circadian rhythm proteins, tran 99.5
4h10_B71 Circadian locomoter output cycles protein kaput; B 99.49
1a0a_A63 BHLH, protein (phosphate system positive regulator 99.32
1an4_A65 Protein (upstream stimulatory factor); protein-DNA 99.3
1am9_A82 Srebp-1A, protein (sterol regulatory element bindi 99.23
4ati_A118 MITF, microphthalmia-associated transcription fact 99.23
1nkp_B83 MAX protein, MYC proto-oncogene protein; transcrip 99.1
1hlo_A80 Protein (transcription factor MAX); transcriptiona 99.07
1nkp_A88 C-MYC, MYC proto-oncogene protein; transcription, 98.93
1mdy_A68 Protein (MYOD BHLH domain); protein-DNA complex, t 98.82
2ql2_B60 Neurod1, neurogenic differentiation factor 1; basi 98.74
3u5v_A76 Protein MAX, transcription factor E2-alpha chimer; 98.73
1nlw_A80 MAD protein, MAX dimerizer; transcription factor, 98.71
2lfh_A68 DNA-binding protein inhibitor ID-3; structural gen 98.61
4ath_A83 MITF, microphthalmia-associated transcription fact 98.14
4aya_A97 DNA-binding protein inhibitor ID-2; cell cycle; 2. 97.86
>4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
Probab=99.66  E-value=1.7e-17  Score=100.58  Aligned_cols=53  Identities=34%  Similarity=0.510  Sum_probs=47.4

Q ss_pred             CchhHHHhHHHhHHHHHHHHhcCCCCCccccchHHHHHHHHHHHHHHhhhhhh
Q psy8266          14 KSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQ   66 (68)
Q Consensus        14 ~~~aeK~RRdk~N~~~~~L~~lLP~~~~~~~kLDKaSILrlti~yLk~~~~~~   66 (68)
                      +..+||+||+++|+.|.+|+.|||.+.+..+++||++||++||+||+....|.
T Consensus        13 H~~~ERrRR~rIN~~l~eL~~LvP~~~~~~~KldKasIL~~tV~ylk~l~~~~   65 (73)
T 4h10_A           13 HSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAW   65 (73)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHSHHHHTCSSCCCHHHHHHHHHHHHHHHSCC-
T ss_pred             cchHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHhcCc
Confidence            45689999999999999999999976666789999999999999999987764



>4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Back     alignment and structure
>4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} Back     alignment and structure
>1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 Back     alignment and structure
>1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C Back     alignment and structure
>4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A Back     alignment and structure
>1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B Back     alignment and structure
>1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* Back     alignment and structure
>2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} Back     alignment and structure
>3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* Back     alignment and structure
>1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 Back     alignment and structure
>2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} Back     alignment and structure
>4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 68
d1an4a_65 a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien 0.001
d1a0aa_63 a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa 0.001
d1nkpb_83 a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T 0.004
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Usf B/HLH domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 31.7 bits (72), Expect = 0.001
 Identities = 9/45 (20%), Positives = 23/45 (51%), Gaps = 2/45 (4%)

Query: 19 KRHRERLNAELDTLANLLP--FEQNILSKLDRLSILRLSVSYLRT 61
          +R R+++N  +  L+ ++P    ++  S   +  IL  +  Y++ 
Sbjct: 14 RRRRDKINNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQE 58


>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query68
d1a0aa_63 Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce 99.37
d1mdya_68 Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 99.24
d1nlwa_79 Mad protein {Human (Homo sapiens) [TaxId: 9606]} 99.2
d1an4a_65 Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 99.18
d1am9a_80 SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1nkpb_83 Max protein {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1nkpa_88 Myc proto-oncogene protein {Human (Homo sapiens) [ 99.08
d1uklc_61 SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} 98.64
>d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HLH-like
superfamily: HLH, helix-loop-helix DNA-binding domain
family: HLH, helix-loop-helix DNA-binding domain
domain: Pho4 B/HLH domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.37  E-value=2e-13  Score=78.16  Aligned_cols=52  Identities=23%  Similarity=0.422  Sum_probs=44.5

Q ss_pred             CCCCchhHHHhHHHhHHHHHHHHhcCCC---CCccccchHHHHHHHHHHHHHHhh
Q psy8266          11 GVTKSNPSKRHRERLNAELDTLANLLPF---EQNILSKLDRLSILRLSVSYLRTK   62 (68)
Q Consensus        11 ~~~~~~aeK~RRdk~N~~~~~L~~lLP~---~~~~~~kLDKaSILrlti~yLk~~   62 (68)
                      +..+..+||+||+++|+.|.+|..+||-   ..+...++||++||+.||.|++.-
T Consensus         3 R~~H~~~Er~RR~~in~~~~~L~~llP~~~~~~~~~~k~sKa~iL~~Av~yI~~L   57 (63)
T d1a0aa_           3 RESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHL   57 (63)
T ss_dssp             TTGGGGGTHHHHHHHHHHHHHHHHTSCHHHHTSSCCCCSCTTHHHHHHHHHHHHH
T ss_pred             cchHHHHHHHHHHHHHHHHHHHHHHCCCcccccCCcccccHHHHHHHHHHHHHHH
Confidence            3456789999999999999999999993   234568999999999999999863



>d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure