Psyllid ID: psy8266
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 68 | ||||||
| 195500996 | 1062 | GE26316 [Drosophila yakuba] gi|194183713 | 0.941 | 0.060 | 0.968 | 2e-27 | |
| 195107625 | 1064 | GI23647 [Drosophila mojavensis] gi|19391 | 0.941 | 0.060 | 0.968 | 2e-27 | |
| 194901278 | 1057 | GG19993 [Drosophila erecta] gi|190651882 | 0.941 | 0.060 | 0.968 | 2e-27 | |
| 195152766 | 1100 | GL22243 [Drosophila persimilis] gi|19411 | 0.941 | 0.058 | 0.968 | 2e-27 | |
| 386765904 | 1015 | spineless, isoform C [Drosophila melanog | 0.941 | 0.063 | 0.968 | 2e-27 | |
| 195037953 | 1082 | GH18248 [Drosophila grimshawi] gi|193894 | 0.941 | 0.059 | 0.968 | 2e-27 | |
| 195389004 | 1099 | GJ23490 [Drosophila virilis] gi|19415125 | 0.941 | 0.058 | 0.968 | 2e-27 | |
| 195451109 | 1031 | GK13504 [Drosophila willistoni] gi|19416 | 0.941 | 0.062 | 0.968 | 2e-27 | |
| 390178920 | 878 | GA20013, isoform B [Drosophila pseudoobs | 0.955 | 0.074 | 0.953 | 2e-27 | |
| 3132524 | 884 | Ahr homolog spineless [Drosophila melano | 0.941 | 0.072 | 0.968 | 2e-27 |
| >gi|195500996|ref|XP_002097612.1| GE26316 [Drosophila yakuba] gi|194183713|gb|EDW97324.1| GE26316 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Score = 126 bits (316), Expect = 2e-27, Method: Compositional matrix adjust.
Identities = 62/64 (96%), Positives = 63/64 (98%)
Query: 3 SLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTK 62
SLKPPPKDGVTKSNPSKRHRERLNAELD LA+LLPFEQNILSKLDRLSILRLSVSYLRTK
Sbjct: 19 SLKPPPKDGVTKSNPSKRHRERLNAELDLLASLLPFEQNILSKLDRLSILRLSVSYLRTK 78
Query: 63 SYFQ 66
SYFQ
Sbjct: 79 SYFQ 82
|
Source: Drosophila yakuba Species: Drosophila yakuba Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195107625|ref|XP_001998409.1| GI23647 [Drosophila mojavensis] gi|193915003|gb|EDW13870.1| GI23647 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|194901278|ref|XP_001980179.1| GG19993 [Drosophila erecta] gi|190651882|gb|EDV49137.1| GG19993 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|195152766|ref|XP_002017307.1| GL22243 [Drosophila persimilis] gi|194112364|gb|EDW34407.1| GL22243 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|386765904|ref|NP_001247140.1| spineless, isoform C [Drosophila melanogaster] gi|386765906|ref|NP_001163629.2| spineless, isoform D [Drosophila melanogaster] gi|383292749|gb|AFH06458.1| spineless, isoform C [Drosophila melanogaster] gi|383292750|gb|ACZ94925.2| spineless, isoform D [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|195037953|ref|XP_001990425.1| GH18248 [Drosophila grimshawi] gi|193894621|gb|EDV93487.1| GH18248 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|195389004|ref|XP_002053168.1| GJ23490 [Drosophila virilis] gi|194151254|gb|EDW66688.1| GJ23490 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
| >gi|195451109|ref|XP_002072771.1| GK13504 [Drosophila willistoni] gi|194168856|gb|EDW83757.1| GK13504 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|390178920|ref|XP_001359453.3| GA20013, isoform B [Drosophila pseudoobscura pseudoobscura] gi|388859639|gb|EAL28599.3| GA20013, isoform B [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|3132524|gb|AAD09205.1| Ahr homolog spineless [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 68 | ||||||
| FB|FBgn0003513 | 1048 | ss "spineless" [Drosophila mel | 0.941 | 0.061 | 0.968 | 2e-26 | |
| UNIPROTKB|F1SEI6 | 385 | F1SEI6 "Uncharacterized protei | 0.941 | 0.166 | 0.661 | 8.9e-19 | |
| UNIPROTKB|E5RFG4 | 157 | AHRR "Aryl hydrocarbon recepto | 0.911 | 0.394 | 0.725 | 1.4e-18 | |
| UNIPROTKB|E5RGQ2 | 81 | AHRR "Aryl hydrocarbon recepto | 0.911 | 0.765 | 0.725 | 1.4e-18 | |
| UNIPROTKB|G3V143 | 139 | AHRR "Aryl hydrocarbon recepto | 0.911 | 0.446 | 0.725 | 1.4e-18 | |
| UNIPROTKB|I3L5U3 | 394 | I3L5U3 "Uncharacterized protei | 0.911 | 0.157 | 0.682 | 1.7e-18 | |
| UNIPROTKB|F1NLX8 | 839 | AHR "Uncharacterized protein" | 0.897 | 0.072 | 0.725 | 2.4e-18 | |
| UNIPROTKB|G3V6M2 | 853 | Ahr "RCG61977, isoform CRA_b" | 0.911 | 0.072 | 0.698 | 4e-18 | |
| RGD|2074 | 853 | Ahr "aryl hydrocarbon receptor | 0.911 | 0.072 | 0.682 | 8.3e-18 | |
| UNIPROTKB|P35869 | 848 | AHR "Aryl hydrocarbon receptor | 0.911 | 0.073 | 0.682 | 1.1e-17 |
| FB|FBgn0003513 ss "spineless" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 310 (114.2 bits), Expect = 2.0e-26, P = 2.0e-26
Identities = 62/64 (96%), Positives = 63/64 (98%)
Query: 3 SLKPPPKDGVTKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTK 62
SLKPPPKDGVTKSNPSKRHRERLNAELD LA+LLPFEQNILSKLDRLSILRLSVSYLRTK
Sbjct: 19 SLKPPPKDGVTKSNPSKRHRERLNAELDLLASLLPFEQNILSKLDRLSILRLSVSYLRTK 78
Query: 63 SYFQ 66
SYFQ
Sbjct: 79 SYFQ 82
|
|
| UNIPROTKB|F1SEI6 F1SEI6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5RFG4 AHRR "Aryl hydrocarbon receptor repressor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E5RGQ2 AHRR "Aryl hydrocarbon receptor repressor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V143 AHRR "Aryl hydrocarbon receptor repressor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L5U3 I3L5U3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NLX8 AHR "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V6M2 Ahr "RCG61977, isoform CRA_b" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2074 Ahr "aryl hydrocarbon receptor" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P35869 AHR "Aryl hydrocarbon receptor" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 68 | |||
| smart00353 | 53 | smart00353, HLH, helix loop helix domain | 1e-05 | |
| cd00083 | 60 | cd00083, HLH, Helix-loop-helix domain, found in sp | 1e-05 | |
| pfam00010 | 52 | pfam00010, HLH, Helix-loop-helix DNA-binding domai | 8e-04 |
| >gnl|CDD|197674 smart00353, HLH, helix loop helix domain | Back alignment and domain information |
|---|
Score = 38.0 bits (89), Expect = 1e-05
Identities = 15/42 (35%), Positives = 24/42 (57%), Gaps = 1/42 (2%)
Query: 19 KRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLR 60
+R R ++N D L +LLP KL + ILRL++ Y++
Sbjct: 5 RRRRRKINEAFDELRSLLPTLPKN-KKLSKAEILRLAIEYIK 45
|
Length = 53 |
| >gnl|CDD|238036 cd00083, HLH, Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >gnl|CDD|215654 pfam00010, HLH, Helix-loop-helix DNA-binding domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 68 | |||
| KOG3558|consensus | 768 | 99.74 | ||
| KOG3560|consensus | 712 | 99.72 | ||
| KOG3559|consensus | 598 | 99.47 | ||
| PF00010 | 55 | HLH: Helix-loop-helix DNA-binding domain only nucl | 99.34 | |
| KOG3561|consensus | 803 | 99.32 | ||
| cd00083 | 60 | HLH Helix-loop-helix domain, found in specific DNA | 99.31 | |
| smart00353 | 53 | HLH helix loop helix domain. | 99.3 | |
| KOG4304|consensus | 250 | 99.2 | ||
| KOG1318|consensus | 411 | 98.31 | ||
| KOG1319|consensus | 229 | 97.4 | ||
| KOG4029|consensus | 228 | 97.37 | ||
| KOG2483|consensus | 232 | 96.13 | ||
| KOG0561|consensus | 373 | 96.0 | ||
| KOG2588|consensus | 953 | 95.93 | ||
| KOG3960|consensus | 284 | 95.81 | ||
| PLN03217 | 93 | transcription factor ATBS1; Provisional | 95.32 |
| >KOG3558|consensus | Back alignment and domain information |
|---|
Probab=99.74 E-value=1.2e-18 Score=140.49 Aligned_cols=54 Identities=37% Similarity=0.624 Sum_probs=52.7
Q ss_pred CCchhHHHhHHHhHHHHHHHHhcCCCCCccccchHHHHHHHHHHHHHHhhhhhh
Q psy8266 13 TKSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQ 66 (68)
Q Consensus 13 ~~~~aeK~RRdk~N~~~~~L~~lLP~~~~~~~kLDKaSILrlti~yLk~~~~~~ 66 (68)
+||+|+|+||.|||++|+||+.+||++++++++||||||||+||+|||+++|+.
T Consensus 49 kSRdAARsRRsKEn~~FyeLa~~lPlp~aisshLDkaSimRLtISyLRlrk~a~ 102 (768)
T KOG3558|consen 49 KSRDAARSRRSKENEEFYELAKLLPLPAAISSHLDKASIMRLTISYLRLRKFAG 102 (768)
T ss_pred hhhhhhhhhcccchHHHHHHHHhCCCcchhhhhhhhHHHHHHHHHHHHHHHHhh
Confidence 799999999999999999999999999999999999999999999999999975
|
|
| >KOG3560|consensus | Back alignment and domain information |
|---|
| >KOG3559|consensus | Back alignment and domain information |
|---|
| >PF00010 HLH: Helix-loop-helix DNA-binding domain only nuclear translocator protein (Arnt) | Back alignment and domain information |
|---|
| >KOG3561|consensus | Back alignment and domain information |
|---|
| >cd00083 HLH Helix-loop-helix domain, found in specific DNA- binding proteins that act as transcription factors; 60-100 amino acids long | Back alignment and domain information |
|---|
| >smart00353 HLH helix loop helix domain | Back alignment and domain information |
|---|
| >KOG4304|consensus | Back alignment and domain information |
|---|
| >KOG1318|consensus | Back alignment and domain information |
|---|
| >KOG1319|consensus | Back alignment and domain information |
|---|
| >KOG4029|consensus | Back alignment and domain information |
|---|
| >KOG2483|consensus | Back alignment and domain information |
|---|
| >KOG0561|consensus | Back alignment and domain information |
|---|
| >KOG2588|consensus | Back alignment and domain information |
|---|
| >KOG3960|consensus | Back alignment and domain information |
|---|
| >PLN03217 transcription factor ATBS1; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 68 | ||||
| 4f3l_B | 387 | Crystal Structure Of The Heterodimeric Clock:bmal1 | 1e-04 | ||
| 4h10_A | 73 | Intermolecular Recognition Revealed By The Complex | 1e-04 |
| >pdb|4F3L|B Chain B, Crystal Structure Of The Heterodimeric Clock:bmal1 Transcriptional Activator Complex Length = 387 | Back alignment and structure |
|
| >pdb|4H10|A Chain A, Intermolecular Recognition Revealed By The Complex Structure Of Human Clock-bmal1 Basic Helix-loop-helix Domains With E-box Dna Length = 73 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 68 | |||
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 5e-21 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 4e-20 |
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 387 | Back alignment and structure |
|---|
Score = 82.7 bits (204), Expect = 5e-21
Identities = 18/54 (33%), Positives = 34/54 (62%)
Query: 14 KSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQE 67
S KR R+++N+ +D LA+L+P + KLD+L++LR++V +++T
Sbjct: 17 HSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGATN 70
|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 68 | |||
| 4h10_A | 73 | ARYL hydrocarbon receptor nuclear translocator-LI | 99.66 | |
| 4f3l_A | 361 | Mclock, circadian locomoter output cycles protein | 99.56 | |
| 4f3l_B | 387 | BMAL1B; BHLH, PAS, circadian rhythm proteins, tran | 99.5 | |
| 4h10_B | 71 | Circadian locomoter output cycles protein kaput; B | 99.49 | |
| 1a0a_A | 63 | BHLH, protein (phosphate system positive regulator | 99.32 | |
| 1an4_A | 65 | Protein (upstream stimulatory factor); protein-DNA | 99.3 | |
| 1am9_A | 82 | Srebp-1A, protein (sterol regulatory element bindi | 99.23 | |
| 4ati_A | 118 | MITF, microphthalmia-associated transcription fact | 99.23 | |
| 1nkp_B | 83 | MAX protein, MYC proto-oncogene protein; transcrip | 99.1 | |
| 1hlo_A | 80 | Protein (transcription factor MAX); transcriptiona | 99.07 | |
| 1nkp_A | 88 | C-MYC, MYC proto-oncogene protein; transcription, | 98.93 | |
| 1mdy_A | 68 | Protein (MYOD BHLH domain); protein-DNA complex, t | 98.82 | |
| 2ql2_B | 60 | Neurod1, neurogenic differentiation factor 1; basi | 98.74 | |
| 3u5v_A | 76 | Protein MAX, transcription factor E2-alpha chimer; | 98.73 | |
| 1nlw_A | 80 | MAD protein, MAX dimerizer; transcription factor, | 98.71 | |
| 2lfh_A | 68 | DNA-binding protein inhibitor ID-3; structural gen | 98.61 | |
| 4ath_A | 83 | MITF, microphthalmia-associated transcription fact | 98.14 | |
| 4aya_A | 97 | DNA-binding protein inhibitor ID-2; cell cycle; 2. | 97.86 |
| >4h10_A ARYL hydrocarbon receptor nuclear translocator-LI 1; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.66 E-value=1.7e-17 Score=100.58 Aligned_cols=53 Identities=34% Similarity=0.510 Sum_probs=47.4
Q ss_pred CchhHHHhHHHhHHHHHHHHhcCCCCCccccchHHHHHHHHHHHHHHhhhhhh
Q psy8266 14 KSNPSKRHRERLNAELDTLANLLPFEQNILSKLDRLSILRLSVSYLRTKSYFQ 66 (68)
Q Consensus 14 ~~~aeK~RRdk~N~~~~~L~~lLP~~~~~~~kLDKaSILrlti~yLk~~~~~~ 66 (68)
+..+||+||+++|+.|.+|+.|||.+.+..+++||++||++||+||+....|.
T Consensus 13 H~~~ERrRR~rIN~~l~eL~~LvP~~~~~~~KldKasIL~~tV~ylk~l~~~~ 65 (73)
T 4h10_A 13 HSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQHMKTLRGAW 65 (73)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHSHHHHTCSSCCCHHHHHHHHHHHHHHHSCC-
T ss_pred cchHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHhcCc
Confidence 45689999999999999999999976666789999999999999999987764
|
| >4f3l_A Mclock, circadian locomoter output cycles protein kaput; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4f3l_B BMAL1B; BHLH, PAS, circadian rhythm proteins, transcription-activato; 2.27A {Mus musculus} | Back alignment and structure |
|---|
| >4h10_B Circadian locomoter output cycles protein kaput; BHLH, circadian transcription, transcription-DNA complex; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1a0a_A BHLH, protein (phosphate system positive regulatory protein PHO4); transcription factor, basic helix loop helix; HET: DNA; 2.80A {Saccharomyces cerevisiae} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1an4_A Protein (upstream stimulatory factor); protein-DNA complex, double helix, overhanging base, transcription/DNA complex; HET: DNA; 2.90A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1am9_A Srebp-1A, protein (sterol regulatory element binding protein 1A); basic-helix-loop- helix-leucine zipper, transcription factor; HET: DNA; 2.30A {Homo sapiens} SCOP: a.38.1.1 PDB: 1ukl_C | Back alignment and structure |
|---|
| >4ati_A MITF, microphthalmia-associated transcription factor; DNA-binding protein-DNA complex, melanoma; 2.60A {Mus musculus} PDB: 4atk_A | Back alignment and structure |
|---|
| >1nkp_B MAX protein, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 PDB: 1an2_A* 1r05_A 1nlw_B | Back alignment and structure |
|---|
| >1hlo_A Protein (transcription factor MAX); transcriptional regulation, DNA binding, complex (transcription factor MAX/DNA), transcription/DNA complex; HET: DNA; 2.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1nkp_A C-MYC, MYC proto-oncogene protein; transcription, DNA, BHLHZ, heterodimer, transcription/DNA complex; 1.80A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >1mdy_A Protein (MYOD BHLH domain); protein-DNA complex, transcription/DNA complex; HET: DNA; 2.80A {Mus musculus} SCOP: a.38.1.1 PDB: 1mdy_B* | Back alignment and structure |
|---|
| >2ql2_B Neurod1, neurogenic differentiation factor 1; basic-helix-loop-helix; HET: DNA; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >3u5v_A Protein MAX, transcription factor E2-alpha chimer; basic helix-loop-helix (BHLH); 1.70A {Mus musculus} PDB: 2ql2_A* | Back alignment and structure |
|---|
| >1nlw_A MAD protein, MAX dimerizer; transcription factor, DNA, BHLHZ, transcription/DNA complex; 2.00A {Homo sapiens} SCOP: a.38.1.1 | Back alignment and structure |
|---|
| >2lfh_A DNA-binding protein inhibitor ID-3; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ath_A MITF, microphthalmia-associated transcription factor; DNA binding protein, melanoma; HET: MSE; 1.95A {Mus musculus} | Back alignment and structure |
|---|
| >4aya_A DNA-binding protein inhibitor ID-2; cell cycle; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 68 | ||||
| d1an4a_ | 65 | a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapien | 0.001 | |
| d1a0aa_ | 63 | a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Sa | 0.001 | |
| d1nkpb_ | 83 | a.38.1.1 (B:) Max protein {Human (Homo sapiens) [T | 0.004 |
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Usf B/HLH domain species: Human (Homo sapiens) [TaxId: 9606]
Score = 31.7 bits (72), Expect = 0.001
Identities = 9/45 (20%), Positives = 23/45 (51%), Gaps = 2/45 (4%)
Query: 19 KRHRERLNAELDTLANLLP--FEQNILSKLDRLSILRLSVSYLRT 61
+R R+++N + L+ ++P ++ S + IL + Y++
Sbjct: 14 RRRRDKINNWIVQLSKIIPDSSMESTKSGQSKGGILSKASDYIQE 58
|
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 63 | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} Length = 83 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 68 | |||
| d1a0aa_ | 63 | Pho4 B/HLH domain {Baker's yeast (Saccharomyces ce | 99.37 | |
| d1mdya_ | 68 | Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10 | 99.24 | |
| d1nlwa_ | 79 | Mad protein {Human (Homo sapiens) [TaxId: 9606]} | 99.2 | |
| d1an4a_ | 65 | Usf B/HLH domain {Human (Homo sapiens) [TaxId: 960 | 99.18 | |
| d1am9a_ | 80 | SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d1nkpb_ | 83 | Max protein {Human (Homo sapiens) [TaxId: 9606]} | 99.18 | |
| d1nkpa_ | 88 | Myc proto-oncogene protein {Human (Homo sapiens) [ | 99.08 | |
| d1uklc_ | 61 | SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.64 |
| >d1a0aa_ a.38.1.1 (A:) Pho4 B/HLH domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: HLH-like superfamily: HLH, helix-loop-helix DNA-binding domain family: HLH, helix-loop-helix DNA-binding domain domain: Pho4 B/HLH domain species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.37 E-value=2e-13 Score=78.16 Aligned_cols=52 Identities=23% Similarity=0.422 Sum_probs=44.5
Q ss_pred CCCCchhHHHhHHHhHHHHHHHHhcCCC---CCccccchHHHHHHHHHHHHHHhh
Q psy8266 11 GVTKSNPSKRHRERLNAELDTLANLLPF---EQNILSKLDRLSILRLSVSYLRTK 62 (68)
Q Consensus 11 ~~~~~~aeK~RRdk~N~~~~~L~~lLP~---~~~~~~kLDKaSILrlti~yLk~~ 62 (68)
+..+..+||+||+++|+.|.+|..+||- ..+...++||++||+.||.|++.-
T Consensus 3 R~~H~~~Er~RR~~in~~~~~L~~llP~~~~~~~~~~k~sKa~iL~~Av~yI~~L 57 (63)
T d1a0aa_ 3 RESHKHAEQARRNRLAVALHELASLIPAEWKQQNVSAAPSKATTVEAACRYIRHL 57 (63)
T ss_dssp TTGGGGGTHHHHHHHHHHHHHHHHTSCHHHHTSSCCCCSCTTHHHHHHHHHHHHH
T ss_pred cchHHHHHHHHHHHHHHHHHHHHHHCCCcccccCCcccccHHHHHHHHHHHHHHH
Confidence 3456789999999999999999999993 234568999999999999999863
|
| >d1mdya_ a.38.1.1 (A:) Myod B/HLH domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nlwa_ a.38.1.1 (A:) Mad protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1an4a_ a.38.1.1 (A:) Usf B/HLH domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1am9a_ a.38.1.1 (A:) SREBP-1a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpb_ a.38.1.1 (B:) Max protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkpa_ a.38.1.1 (A:) Myc proto-oncogene protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uklc_ a.38.1.1 (C:) SREBP-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|