Diaphorina citri psyllid: psy8268


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-
MPVACRRMVKLYLTNPAQTTLLCQYLLSLARYDQNYDIRDRARLLRQLLFPAPGAEIISYF
ccHHHHHHHHEEEEcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccccc
***ACRRMVKLYLTNPAQTTLLCQYLLSLARYDQNYDIRDRARLLRQLLFPA*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVACRRMVKLYLTNPAQTTLLCQYLLSLARYDQNYDIRDRARLLRQLLFPAPGAEIISYF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
AP-3 complex subunit beta-2 Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles.confidentQ9JME5
AP-3 complex subunit beta-2 Subunit of non-clathrin- and clathrin-associated adaptor protein complex 3 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. AP-3 appears to be involved in the sorting of a subset of transmembrane proteins targeted to lysosomes and lysosome-related organelles.confidentQ13367

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005794 [CC]Golgi apparatusconfidentGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032438 [BP]melanosome organizationprobableGO:0006996, GO:0043473, GO:0048753, GO:0071840, GO:0009987, GO:0016050, GO:0033059, GO:0044763, GO:0016043, GO:0008150, GO:0044699
GO:0019903 [MF]protein phosphatase bindingprobableGO:0019902, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0006886 [BP]intracellular protein transportprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0008089 [BP]anterograde axon cargo transportprobableGO:0051234, GO:0007017, GO:0046907, GO:0006810, GO:0007018, GO:0008088, GO:0030705, GO:0044765, GO:0010970, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0006928, GO:0051179, GO:0044699, GO:0051641
GO:0048490 [BP]anterograde synaptic vesicle transportprobableGO:0019226, GO:0035637, GO:0051649, GO:0023052, GO:0051656, GO:0051650, GO:0044699, GO:0048489, GO:0097480, GO:0097479, GO:0051641, GO:0032501, GO:0050877, GO:0006810, GO:0044765, GO:0008150, GO:0051648, GO:0007268, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051640, GO:0003008, GO:0044700, GO:0016192, GO:0044707, GO:0044763, GO:0009987
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006892 [BP]post-Golgi vesicle-mediated transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0030123 [CC]AP-3 adaptor complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0030117, GO:0044424, GO:0044425, GO:0030119, GO:0048475
GO:0005802 [CC]trans-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0030137 [CC]COPI-coated vesicleprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0005798, GO:0005623, GO:0031988, GO:0044446, GO:0044431, GO:0043227, GO:0005575, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0044422, GO:0031982
GO:0005215 [MF]transporter activityprobableGO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2VGL, chain B
Confidence level:very confident
Coverage over the Query: 4-53
View the alignment between query and template
View the model in PyMOL