Diaphorina citri psyllid: psy8280


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MEDPSGTEIPFPGTQNGTGDPDPDPRDEDLARIEILTLLVILIITLIGNLMVLAALYSRRHYRKQIKMSRMYYFILHLSIADLVTGVFNVLPQLWWDINYRFPGQSNWTCKLVKFVQPSGSFLSSYILMAIAIDRYRAICHPLTYHTYFYLIGRVEHN
cccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccc
******T***FPGTQN********PRDEDLARIEILTLLVILIITLIGNLMVLAALYSRRHYRKQIKMSRMYYFILHLSIADLVTGVFNVLPQLWWDINYRFPGQSNWTCKLVKFVQPSGSFLSSYILMAIAIDRYRAICHPLTYHTYFYLIGRV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDPSGTEIPFPGTQNGTGDPDPDPRDEDLARIEILTLLVILIITLIGNLMVLAALYSRRHYRKQIKMSRMYYFILHLSIADLVTGVFNVLPQLWWDINYRFPGQSNWTCKLVKFVQPSGSFLSSYILMAIAIDRYRAICHPLTYHTYFYLIGRVEHN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0017046 [MF]peptide hormone bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0042562, GO:0005488
GO:0007218 [BP]neuropeptide signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0007186, GO:0050789, GO:0044699
GO:0001653 [MF]peptide receptor activityprobableGO:0003674, GO:0038023, GO:0004872, GO:0004871, GO:0060089
GO:0016500 [MF]protein-hormone receptor activityprobableGO:0004930, GO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EA3, chain A
Confidence level:very confident
Coverage over the Query: 27-142
View the alignment between query and template
View the model in PyMOL
Template: 2KS9, chain A
Confidence level:very confident
Coverage over the Query: 2-146
View the alignment between query and template
View the model in PyMOL