Diaphorina citri psyllid: psy8285


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------
NNQCHLSAVKAIAWCPWEPTLLATGGGICDQTVRLWNSMNGKEKCHVKTDSQVTSILWSEQYRESSRSKMVNTDRYVVDRSSYDSLCSHYLLQQANDETISYREQKKRRHLSFLLHGFEIDRKKVLNQSKRTVSPTQFLRTLGKLPRKVKAKPERILEAPSIINDFYTSGLDWGYHDTLAVALDTSVYTWNTKTNKTQLLVEYPTYDNAYISCVAWKPRTTDLAVTNTCTEYIDLWHEQEERLIQKLRTHMHQVIAMCWNGNLLSCGTIGGNILHYDVRTHSDYPTAITREGDVVCGLKWSPNGRYLASGSNNTVKIWDFRQLDAKRPQVNNQCHLSAVKAIAWCPWEPTLLATGGGICDQTVRLWNSMNGKEKCHVKTDSQVTSILWSEQYRELVTSHGKQDCSLKMWEYPRLHLIEELKIHQERILSAVLSPDQTCVAAASADETISIWNCFPRDKKRKARQVGSGSSLEFAILKQPVSLTALLRSRAVEKQQHAIAYTVFGEAV
ccccccccEEEEEEccccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEEEccccccccccccccccccEEEEEccccccccccEEccccccccHHcccccccEEEEEcccEEEcEEEEEEcccccccccccccccccccEEEcccccCEEEccccccccEEEEEEcccccEEEEEcccEEEEEEcccccEEEEEEccccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEEcccEEEEEcccccEEEcccccccccccccccccccEEEEEEcccccEEEECccccEEEEEcccccccccEEEcccccccEEEEEEccccccEEEEEccccccEEEEEEcccccEEEEccccccEEEEEEcccccEEEEccccccccEEEEEcccccEEEEEccccccEEEEEEcccccEEEEEcccccEEEEEcccccccccEEccccccEEEEEEEEcccccEEEEEEccccccEEEEEcccccEEc
***CHLSAVKAIAWCPWEPTLLATGGGICDQTVRLWNSMNGKEKCHVKTDSQVTSILWSEQ*********VNTDRYVVDRSSYDSLCSHYLLQQANDETISYREQKKRRHLSFLLHGFEIDRKKVLNQSK*****TQFLRTLGKLPRKVKAKPERILEAPSIINDFYTSGLDWGYHDTLAVALDTSVYTWNTKTNKTQLLVEYPTYDNAYISCVAWKPRTTDLAVTNTCTEYIDLWHEQEERLIQKLRTHMHQVIAMCWNGNLLSCGTIGGNILHYDVRTHSDYPTAITREGDVVCGLKWSPNGRYLASGSNNTVKIWDFRQLDAKRPQVNNQCHLSAVKAIAWCPWEPTLLATGGGICDQTVRLWNSMNGKEKCHVKTDSQVTSILWSEQYRELVTSHGKQDCSLKMWEYPRLHLIEELKIHQERILSAVLSPDQTCVAAASADETISIWNCFPR**************LEFAILKQPVSLTALLRSRAVEKQQHAIAYTVFGE**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NNQCHLSAVKAIAWCPWEPTLLATGGGICDQTVRLWNSMNGKEKCHVKTDSQVTSILWSEQYRESSRSKMVNTDRYVVDRSSYDSLCSHYLLQQANDETISYREQKKRRHLSFLLHGFEIDRKKVLNQSKRTVSPTQFLRTLGKLPRKVKAKPERILEAPSIINDFYTSGLDWGYHDTLAVALDTSVYTWNTKTNKTQLLVEYPTYDNAYISCVAWKPRTTDLAVTNTCTEYIDLWHEQEERLIQKLRTHMHQVIAMCWNGNLLSCGTIGGNILHYDVRTHSDYPTAITREGDVVCGLKWSPNGRYLASGSNNTVKIWDFRQLDAKRPQVNNQCHLSAVKAIAWCPWEPTLLATGGGICDQTVRLWNSMNGKEKCHVKTDSQVTSILWSEQYRELVTSHGKQDCSLKMWEYPRLHLIEELKIHQERILSAVLSPDQTCVAAASADETISIWNCFPRDKKRKARQVGSGSSLEFAILKQPVSLTALLRSRAVEKQQHAIAYTVFGEAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cell division cycle protein 20 homolog Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.confidentQ5H7C0
Anaphase-promoting complex subunit cdc20 Component of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated E3 ubiquitin-protein ligase complex that controls progression through mitosis and the G1 phase of the cell cycle.confidentQ54MZ3
Cell division cycle protein 20 homolog Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation (By similarity). Interacts with NEK2.confidentQ62623

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005680 [CC]anaphase-promoting complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0000151, GO:0000152, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0031461, GO:0043227, GO:0043226, GO:0044422
GO:0090129 [BP]positive regulation of synapse maturationprobableGO:0019226, GO:0035637, GO:0050803, GO:0050807, GO:0051128, GO:0090128, GO:0023052, GO:0050789, GO:0044699, GO:0065007, GO:0048518, GO:0065008, GO:0051130, GO:0032501, GO:0050793, GO:0050877, GO:0009987, GO:0050794, GO:0008150, GO:0051239, GO:0007268, GO:0007267, GO:0007154, GO:0003008, GO:0044700, GO:0044707, GO:0051094, GO:0051960, GO:2000026, GO:0044763, GO:0048522
GO:0010001 [BP]glial cell differentiationprobableGO:0032502, GO:0009987, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0042063, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699, GO:0048856
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0090068 [BP]positive regulation of cell cycle processprobableGO:0051726, GO:0010564, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0022403 [BP]cell cycle phaseprobableGO:0022402, GO:0009987, GO:0008150, GO:0007049, GO:0044763, GO:0044699
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0008054 [BP]cyclin catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0030071 [BP]regulation of mitotic metaphase/anaphase transitionprobableGO:0007346, GO:0033043, GO:0008150, GO:0051726, GO:0010564, GO:0050794, GO:0051783, GO:1901987, GO:0065007, GO:1901990, GO:0051128, GO:0007088, GO:1902099, GO:0050789
GO:0040020 [BP]regulation of meiosisprobableGO:0051445, GO:0051726, GO:2000241, GO:0010564, GO:0050794, GO:0065007, GO:0008150, GO:0050789
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0097027 [MF]ubiquitin-protein ligase activator activityprobableGO:0055103, GO:0003674, GO:0030234, GO:0055106
GO:0000778 [CC]condensed nuclear chromosome kinetochoreprobableGO:0031974, GO:0000780, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0000779, GO:0000794, GO:0000775, GO:0000776, GO:0000777, GO:0043234, GO:0032991, GO:0043231, GO:0043232, GO:0000793, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0044732 [CC]mitotic spindle pole bodyprobableGO:0043234, GO:0005856, GO:0072686, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005816, GO:0044422, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0005819, GO:0044430, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630, GO:0005622
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:2000060 [BP]positive regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic processprobableGO:0009894, GO:0009893, GO:0031329, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0019222, GO:0051246, GO:0051247, GO:2000058, GO:0032270, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0060255, GO:0050794, GO:0048518, GO:0030162, GO:0010604, GO:0032268, GO:0031401, GO:0008150, GO:0048522
GO:0033597 [CC]mitotic checkpoint complexprobableGO:0043234, GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0048468 [BP]cell developmentprobableGO:0032502, GO:0048856, GO:0048869, GO:0030154, GO:0044767, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0031572 [BP]G2 DNA damage checkpointprobableGO:0010948, GO:0050789, GO:0044699, GO:0051716, GO:0031570, GO:0010564, GO:0065007, GO:0048519, GO:0009987, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0033554, GO:0044763, GO:0048523
GO:0045335 [CC]phagocytic vesicleprobableGO:0005737, GO:0005575, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0030139, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0051437 [BP]positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycleprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051439, GO:0051438, GO:0050789, GO:0007049, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044699, GO:0031398, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0043085, GO:0009987, GO:0000278, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0044763, GO:0032268, GO:0051443, GO:0022402, GO:0031401, GO:0051351, GO:0008150, GO:0044093, GO:0048522
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045595 [BP]regulation of cell differentiationprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0051093 [BP]negative regulation of developmental processprobableGO:0050793, GO:0048519, GO:0065007, GO:0050789, GO:0008150
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009888 [BP]tissue developmentprobableGO:0032502, GO:0048856, GO:0008150
GO:0032153 [CC]cell division siteprobableGO:0005575, GO:0044464, GO:0005623
GO:0030332 [MF]cyclin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051179 [BP]localizationprobableGO:0008150
GO:0031145 [BP]anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0090302 [MF]mitotic anaphase-promoting complex activityprobableGO:0019787, GO:0016879, GO:0004842, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0007126 [BP]meiosisprobableGO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0031915 [BP]positive regulation of synaptic plasticityprobableGO:0065008, GO:0044057, GO:0031644, GO:0050804, GO:0048167, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789, GO:0050794
GO:0005814 [CC]centrioleprobableGO:0005737, GO:0005856, GO:0015630, GO:0043228, GO:0005575, GO:0043232, GO:0005813, GO:0044464, GO:0044444, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044450, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:2000600 [BP]positive regulation of cyclin catabolic processprobableGO:0009896, GO:0009894, GO:0032436, GO:0009893, GO:0032434, GO:0031325, GO:0031323, GO:0042176, GO:0050789, GO:0080090, GO:0031329, GO:0051246, GO:0051247, GO:0008150, GO:0032270, GO:0061136, GO:0048518, GO:0065007, GO:2000598, GO:0060255, GO:0031331, GO:1901800, GO:0050794, GO:0030162, GO:0019222, GO:0010604, GO:0032268, GO:0045732, GO:0045862, GO:0048522
GO:0051488 [BP]activation of anaphase-promoting complex activityprobableGO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0051438, GO:0050789, GO:0043085, GO:0080090, GO:0051340, GO:0010604, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0031396, GO:0065007, GO:0065009, GO:0031398, GO:0060255, GO:0050790, GO:0050794, GO:0048518, GO:0008150, GO:0032268, GO:0051443, GO:0031401, GO:0051351, GO:0048522
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0009653 [BP]anatomical structure morphogenesisprobableGO:0032502, GO:0048856, GO:0008150
GO:0010997 [MF]anaphase-promoting complex bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YMU, chain A
Confidence level:very confident
Coverage over the Query: 2-79,90-478
View the alignment between query and template
View the model in PyMOL
Template: 4GGA, chain A
Confidence level:very confident
Coverage over the Query: 146-459
View the alignment between query and template
View the model in PyMOL
Template: 4AOW, chain A
Confidence level:very confident
Coverage over the Query: 195-503
View the alignment between query and template
View the model in PyMOL