Diaphorina citri psyllid: psy8359


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
MLVAVLISSNGISSVSLNKSKTRAWNRDTCSSLFPPRKQALSTHEKSPIQISIKVNVSSVEKVDLAKRLLVGKSASVDAEKSMLSKLKQECGGGFTSKLEGMFKDMELSKDINVAFKQYMGNLKEDKESTSNNALGIDLTDADLRRTLQSLACGKTRVLKKTPASRDIEDCDRFRFNNDFTFKLFRIKINQIQMKETNEEQKATEERVFQDRQYQIDAAIVRIMKMRKTLSHNLLLSELFNQLKFPVKPADLKKRIESLIDRDYMERDKDKANSYNYMA
cEEEEEEcccccccccccccccHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccEEEccccccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccccccEEEcc
MLVAVLISS***************WNRDTCSSLFPPR*****THEKSPIQISIKVNVSSVEKVDLAKRLLVGKSASVDAEKSMLSKLKQECGGGFTSKLEGMFKDMELSKDINVAFKQYMGNLKEDKESTSNNALGIDLTDADLRRTLQSLACGKTRVLKKTPASRDIEDCDRFRFNNDFTFKLFRIKINQIQ**************VFQDRQYQIDAAIVRIMKMRKTLSHNLLLSELFNQLKFPVKPADLKKRIESLIDRDYMERDKDKANSYNYMA
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLVAVLISSNGISSVSLNKSKTRAWNRDTCSSLFPPRKQALSTHEKSPIQISIKVNVSSVEKVDLAKRLLVGKSASVDAEKSMLSKLKQECGGGFTSKLEGMFKDMELSKDINVAFKQYMGNLKEDKESTSNNALGIDLTDADLRRTLQSLACGKTRVLKKTPASRDIEDCDRFRFNNDFTFKLFRIKINQIQMKETNEEQKATEERVFQDRQYQIDAAIVRIMKMRKTLSHNLLLSELFNQLKFPVKPADLKKRIESLIDRDYMERDKDKANSYNYMA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cullin-4 Component of the CUL4-RBX1-CDD (COP10-DDB1a-DET1) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Participates in the CDD complex to light-mediated control of development. May repress photomorphogenesis through enhancing COP1 E3 ubiquitin-protein ligase activity. Acts together with the CUL4-DDB1-COP1-SPA E3 ubiquitin-protein ligase complexes in the repression of photomorphogenesis and flowering time. Component ot the CUL4-RBX1-DDB1-PRL1 E3 ubiquitin-protein ligase complex which mediates ubiquitination and subsequent degradation of AKIN10. Component of the CUL4-RBX1-DDB1-DWA1/DWA2 E3 ubiquitin-protein ligase complex that acts as negative regulator in abscisic acid (ABA) signaling and may target ABI5 for degradation.confidentQ8LGH4
Cullin-4B Core component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition subunit. CUL4B may act within the complex as a scaffold protein, contributing to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. Plays a role as part of the E3 ubiquitin-protein ligase complex in polyubiquitination of CDT1, histone H2A, histone H3 and histone H4 in response to radiation-induced DNA damage. Targeted to UV damaged chromatin by DDB2 and may be important for DNA repair and DNA replication. Required for ubiquitination of cyclin E, and consequently, normal G1 cell cycle progression. Regulates the mammalian target-of-rapamycin (mTOR) pathway involved in control of cell growth, size and metabolism. Specific CUL4B regulation of the mTORC1-mediated pathway is dependent upon 26S proteasome function and requires interaction between CUL4B and MLST8.confidentA2A432
Cullin-4B Core component of multiple cullin-RING-based E3 ubiquitin-protein ligase complexes which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. The functional specificity of the E3 ubiquitin-protein ligase complex depends on the variable substrate recognition subunit. CUL4B may act within the complex as a scaffold protein, contributing to catalysis through positioning of the substrate and the ubiquitin-conjugating enzyme. Plays a role as part of the E3 ubiquitin-protein ligase complex in polyubiquitination of CDT1, histone H2A, histone H3 and histone H4 in response to radiation-induced DNA damage. Targeted to UV damaged chromatin by DDB2 and may be important for DNA repair and DNA replication. Required for ubiquitination of cyclin E, and consequently, normal G1 cell cycle progression. Regulates the mammalian target-of-rapamycin (mTOR) pathway involved in control of cell growth, size and metabolism. Specific CUL4B regulation of the mTORC1-mediated pathway is dependent upon 26S proteasome function and requires interaction between CUL4B and MLST8.confidentQ13620

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0031464 [CC]Cul4A-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0080008, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0031465 [CC]Cul4B-RING ubiquitin ligase complexprobableGO:0043234, GO:0032991, GO:0080008, GO:0044464, GO:0000151, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0031461
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0007307 [BP]eggshell chorion gene amplificationprobableGO:0048610, GO:0007306, GO:0030154, GO:0048468, GO:0019953, GO:0010927, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0007304, GO:0034645, GO:1901576, GO:0009653, GO:1901362, GO:0044699, GO:0006139, GO:0007276, GO:0000003, GO:0044260, GO:0030703, GO:0071840, GO:0030707, GO:0016043, GO:0032989, GO:0071704, GO:1901360, GO:0048477, GO:0048646, GO:0018130, GO:0032502, GO:0032501, GO:0048609, GO:0032504, GO:0044238, GO:0009987, GO:0006725, GO:0044767, GO:0022414, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0022412, GO:0034654, GO:0046483, GO:0007292, GO:0044702, GO:0044271, GO:0003006, GO:0048856, GO:0006277, GO:0044237, GO:0043170, GO:0044763, GO:0048869, GO:0006259, GO:0019438, GO:0071897
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0007050 [BP]cell cycle arrestprobableGO:0044699, GO:0045786, GO:0051726, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0022402, GO:0048523, GO:0048519, GO:0044763, GO:0050789, GO:0007049
GO:0051533 [BP]positive regulation of NFAT protein import into nucleusprobableGO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:0042993, GO:0042990, GO:1900180, GO:0051532, GO:0046824, GO:0046822
GO:0006511 [BP]ubiquitin-dependent protein catabolic processprobableGO:0051603, GO:1901575, GO:0044265, GO:0044260, GO:0044267, GO:0019538, GO:0009056, GO:0009987, GO:0019941, GO:0044237, GO:0043170, GO:0044248, GO:0071704, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0006508, GO:0043632, GO:0044238, GO:0009057
GO:0008285 [BP]negative regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0097193 [BP]intrinsic apoptotic signaling pathwayprobableGO:0010259, GO:0044700, GO:0051716, GO:0009987, GO:0050896, GO:0006915, GO:0097190, GO:0050794, GO:0008150, GO:0012501, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0007569, GO:0050789, GO:0044699
GO:0000082 [BP]G1/S transition of mitotic cell cycleprobableGO:0051325, GO:0044699, GO:0000278, GO:0008150, GO:0009987, GO:0051329, GO:0044770, GO:0044772, GO:0022402, GO:0022403, GO:0044763, GO:0007049
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0000209 [BP]protein polyubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0031625 [MF]ubiquitin protein ligase bindingprobableGO:0003674, GO:0044389, GO:0005515, GO:0019899, GO:0005488
GO:0045750 [BP]positive regulation of S phase of mitotic cell cycleprobable
GO:0007095 [BP]mitotic G2 DNA damage checkpointprobableGO:0010948, GO:0044773, GO:1901991, GO:1901990, GO:0050789, GO:0044699, GO:0051716, GO:0031572, GO:0031570, GO:0010564, GO:0065007, GO:0007049, GO:0048519, GO:0009987, GO:0007346, GO:0050794, GO:0006974, GO:1901987, GO:0006950, GO:0008150, GO:0044774, GO:1901988, GO:0000077, GO:0000075, GO:0051726, GO:0050896, GO:0044763, GO:0033554, GO:0022402, GO:0048523, GO:0007093
GO:0045732 [BP]positive regulation of protein catabolic processprobableGO:0009896, GO:0009894, GO:0009893, GO:0080090, GO:0060255, GO:0051246, GO:0051247, GO:0042176, GO:0065007, GO:0048518, GO:0008150, GO:0019222, GO:0050789, GO:0010604

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2HYE, chain C
Confidence level:very confident
Coverage over the Query: 19-279
View the alignment between query and template
View the model in PyMOL