Diaphorina citri psyllid: psy8363

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530------

MVASPALVPSPSAPLSQSMPGQMRSVGMAPSPSGSLNTPGQAQPTSSPCPTQEDQVYRDKIRQLSKYIEPLRRMIARAANDDIEKTTKMKKLLEILQSPNKRMPLETLLKCEHVLEKLDFKHSSLLRDHHPLLEAVSGALQSSNANHTLQRTFGPCLEILSGPLIKDLPLPVNRKRVEEPADDVPEVLQGEIARLDQRFKVSLDPTQQSGSKAIQLVCWLDDRHLPCVPPIQVSIPEDYPSHPPRCTMGHEHNTTPFLTSVKNALESRIKKLPLKYSVSQLLDTWEMSVRQACAPTRNPTSSPSISVKVKCSELRTKDKKELLKQLEELKTELANLRVAKVTGGAASKLSKIRVVRKAILRVYIVMHQKQKENMRNLIRKEHKKYKPLDLRPKKTRALRRRLTKHERKLKTLKEIRRRQAFPPRKDLPLPVNRKRVEEPADDVPEVLQGEIARLDQRFKVSLDPTQQSGSKAIQLVCWLDDRHLPCVPPIQVSIPEDYPSHPPRCTMGHEHNTTPFLTSVKNALESRIKKLPLKYS

ccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccccccHHHHHHccHHHHHccccccccccccccccccccccccccHHHHHHHHHcccccccccccccccccccEEEEEEEccccccccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccccccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHccHHHHHHccHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHcccccEEEccccccccccEEEEEEEEcccccccccccEEEccccccccccccccccccccccHHHHHHHHHHHHHHHcccccc

************************************************************IRQLSKYIEPLRRMIARAA***********KLLEILQSPNKRMPLETLLKCEHVLEKLDFKHSSLLRDHHPLLEAVSGALQSSNANHTLQRTFGPCLEILSGPLIKDLPLPV*******************IARLDQRFKVS*********KAIQLVCWLDDRHLPCVPPIQVSIPEDYPSHPPRCTMGHEHNTTPFLTSVKNALESRIKKLPLKYSVSQLLDTWEMSVRQ******************************LLKQLEELKTELANLRVAKVTGGAASKLSKIRVVRKAILRVYIVMHQKQKEN*****RKEHKKYKPLDLRPKKTRALRR*******************AFPPRKDL*********************GEIARLDQRFKVSLDPTQQSGSKAIQLVCWLDDRHLPCVPPIQVSIPEDYPSHPPRCTMGHEHNTTPFLTSVKNALESRIKKLP****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MVASPALVPSPSAPLSQSMPGQMRSVGMAPSPSGSLNTPGQAQPTSSPCPTQEDQVYRDKIRQLSKYIEPLRRMIARAANDDIEKTTKMKKLLEILQSPNKRMPLETLLKCEHVLEKLDFKHSSLLRDHHPLLEAVSGALQSSNANHTLQRTFGPCLEILSGPLIKDLPLPVNRKRVEEPADDVPEVLQGEIARLDQRFKVSLDPTQQSGSKAIQLVCWLDDRHLPCVPPIQVSIPEDYPSHPPRCTMGHEHNTTPFLTSVKNALESRIKKLPLKYSVSQLLDTWEMSVRQACAPTRNPTSSPSISVKVKCxxxxxxxxxxxxxxxxxxxxxxxxxxxxKVTGGAASKLSKIRVVRKAILRVYIVMHQKQKENMRNLIRKEHKKYKPLDLRPKKxxxxxxxxxxxxxxxxxxxxxRRRQAFPPRKDLPLPVNRKRVEEPADDVPEVLQGEIARLDQRFKVSLDPTQQSGSKAIQLVCWLDDRHLPCVPPIQVSIPEDYPSHPPRCTMGHEHNTTPFLTSVKNALESRIKKLPLKYS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Mediator of RNA polymerase II transcription subunit 15	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). Required for activated transcription of the MtnA, MtnB and MtnD genes.	confident	Q9Y149
60S ribosomal protein L35		confident	P34662
Mediator of RNA polymerase II transcription subunit 15	Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.	confident	Q5TP13

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0022625 [CC]	cytosolic large ribosomal subunit	probable	GO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005811 [CC]	lipid particle	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZKR, chain v
Confidence level:very confident
Coverage over the Query: 334-369
View the alignment between query and template
View the model in PyMOL