Diaphorina citri psyllid: psy8378


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230
MVGKHWMLGLLRYLGKCYNAAVTTESERGYSRQEKCITALTTCTLEMEREMVKLLPEVLLNLSKISITTSIAIPILEFVSMLTRLPKLFSNFVGDQYMSVFAICMPCTNPFKYNHYTVSLAHHVIAVWFLKCRYWGTPIPMVHCPSCGPVPVPYEALPITLPPSPPLPLASNAEWQHCSCPKCGHGGARRETDTMDTFVDSAWYYVRYLGSGGDPNVRLPDQPDGSRYCD
ccccccccccHHHHHHcccccHHHHHHcccccccccccEEEEccccccHHHHHccccccccccccccccccccccHHHHHcccccccccccccccccccHHHHHHcccccccccccCEEEEEEEEEHHHHHHHHccccccEEEccccccccccccccccccccccccccccccccCCccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccc
***KHWMLGLLRYLGKCYNAAVTTESERGYSRQEKCITALTTCTLEMEREMVKLLPEVLLNLSKISITTSIAIPILEFVSMLTRLPKLFSNFVGDQYMSVFAICMPCTNPFKYNHYTVSLAHHVIAVWFLKCRYWGTPIPMVHCPSCGPVPVPYEALPITLPPSPPLPLASNAEWQHCSCPKCGHGGARRETDTMDTFVDSAWYYVRYLGSGGDPNVRLPDQPDGSRYCD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGKHWMLGLLRYLGKCYNAAVTTESERGYSRQEKCITALTTCTLEMEREMVKLLPEVLLNLSKISITTSIAIPILEFVSMLTRLPKLFSNFVGDQYMSVFAICMPCTNPFKYNHYTVSLAHHVIAVWFLKCRYWGTPIPMVHCPSCGPVPVPYEALPITLPPSPPLPLASNAEWQHCSCPKCGHGGARRETDTMDTFVDSAWYYVRYLGSGGDPNVRLPDQPDGSRYCD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tuberin In complex with TSC1, inhibits the nutrient-mediated or growth factor-stimulated phosphorylation of S6K1 and EIF4EBP1 by negatively regulating mTORC1 signaling. Acts as a GTPase-activating protein (GAP) for the small GTPase RHEB, a direct activator of the protein kinase activity of mTORC1. Implicated as a tumor suppressor. Involved in microtubule-mediated protein transport, but this seems to be due to unregulated mTOR signaling. Stimulates weakly the intrinsic GTPase activity of the Ras-related proteins RAP1A and RAB5 in vitro. Mutations in TSC2 lead to constitutive activation of RAP1A in tumors.confidentP49815

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042325 [BP]regulation of phosphorylationprobableGO:0019220, GO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2V0C, chain A
Confidence level:very confident
Coverage over the Query: 65-226
View the alignment between query and template
View the model in PyMOL