Diaphorina citri psyllid: psy838


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID
cccccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccccEEEEEECccccccEEEEEEEEEECcccEEEEEEEcEEccccccccHHHHHHHHHHcccc
****TKK*GITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYI*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
60S ribosomal protein L37a confidentA4S6Z4
60S ribosomal protein L43 confidentQ6FRG6
60S ribosomal protein L37a confidentQ00VK4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0022625 [CC]cytosolic large ribosomal subunitprobableGO:0005737, GO:0005575, GO:0005622, GO:0022626, GO:0005840, GO:0043232, GO:0005829, GO:0044464, GO:0043229, GO:0005623, GO:0044391, GO:0044446, GO:0044444, GO:0044445, GO:0043226, GO:0044424, GO:0015934, GO:0043228, GO:0030529, GO:0032991, GO:0044422
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167
GO:0019083 [BP]viral transcriptionprobableGO:0048610, GO:0032774, GO:0019080, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:1901362, GO:1901360, GO:0006139, GO:0000003, GO:0044260, GO:0071704, GO:0019058, GO:0051704, GO:0018130, GO:1901576, GO:0009987, GO:0006725, GO:0022415, GO:0022414, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044703, GO:0044271, GO:0044237, GO:0043170, GO:0044764, GO:0016032, GO:0019438
GO:0006614 [BP]SRP-dependent cotranslational protein targeting to membraneprobableGO:0008104, GO:0006613, GO:0006612, GO:0044699, GO:0070972, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0045047, GO:0033365, GO:0044763, GO:0009987
GO:0000022 [BP]mitotic spindle elongationprobableGO:0006996, GO:0044699, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0000226, GO:0008150, GO:0007051, GO:0007052, GO:0022402, GO:0007049, GO:0044763, GO:0051231, GO:0016043
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0000184 [BP]nuclear-transcribed mRNA catabolic process, nonsense-mediated decayprobableGO:0090304, GO:0034641, GO:0006807, GO:1901360, GO:1901361, GO:0006139, GO:1901575, GO:0044265, GO:0044260, GO:0071704, GO:0006401, GO:0006402, GO:0044238, GO:0009987, GO:0006725, GO:0046700, GO:0008150, GO:0008152, GO:0034655, GO:0009056, GO:0009057, GO:0044248, GO:0046483, GO:0016070, GO:0016071, GO:0044270, GO:0044237, GO:0043170, GO:0000956, GO:0019439
GO:0040007 [BP]growthprobableGO:0008150
GO:0003735 [MF]structural constituent of ribosomeprobableGO:0003674, GO:0005198
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0006415 [BP]translational terminationprobableGO:0043933, GO:0044249, GO:0034645, GO:0043241, GO:0044699, GO:0044267, GO:0032984, GO:0044260, GO:0016043, GO:0008150, GO:0071704, GO:0010467, GO:0071840, GO:1901576, GO:0009987, GO:0009058, GO:0009059, GO:0044763, GO:0008152, GO:0043624, GO:0044238, GO:0071822, GO:0019538, GO:0044237, GO:0043170, GO:0022411, GO:0006412
GO:0006414 [BP]translational elongationprobableGO:0071704, GO:0044267, GO:0044238, GO:0008152, GO:0044260, GO:1901576, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:0006412
GO:0006413 [BP]translational initiationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0044763, GO:0034645, GO:1901576, GO:0008150, GO:0006412, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4A17, chain Y
Confidence level:very confident
Coverage over the Query: 2-45
View the alignment between query and template
View the model in PyMOL
Template: 2Q7B, chain A
Confidence level:confident
Coverage over the Query: 44-148
View the alignment between query and template
View the model in PyMOL