Psyllid ID: psy838

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150--
MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID
cccccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccHHHHcccccEEEEEEEccccccEEEEEEEEEEEcccEEEEEEEcEEccccccccHHHHHHHHHHcccc
cccccEEEEEEcccccccHHHHHHHHHHHEEHHccccccccccccHEEHHcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccEEEEEEccccccEEEEEEEEEEcccccEEEEEEEEEEcHHHHHccHHHHHHHHHHHHcc
makrtkkvgitgkygtrYGASLRKMVKKMEITQHAKytcsfcgkeykkstdlgAETKKWVWELEEKNMKhsyevcdigwdpqgkhsemfdDRACYLVakngssstpvafshfrfdvdfgepvLYCYELQLEKQVQRKGLGKFMMQAFYTYID
makrtkkvgitgkygtrygasLRKMVKKMEITQHakytcsfcgkeykkstdlgaETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID
MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID
********GITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYI*
****TKK*GITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYI*
MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID
***RTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAFYTYID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query152 2.2.26 [Sep-21-2011]
Q568K5237 N-alpha-acetyltransferase yes N/A 0.671 0.430 0.524 1e-24
Q86UY6237 N-alpha-acetyltransferase yes N/A 0.671 0.430 0.524 4e-23
Q8VE10237 N-alpha-acetyltransferase yes N/A 0.671 0.430 0.524 4e-23
Q6NUH2236 N-alpha-acetyltransferase N/A N/A 0.651 0.419 0.48 1e-20
Q9VMU492 60S ribosomal protein L37 yes N/A 0.348 0.576 0.830 3e-18
P6151592 Putative 60S ribosomal pr no N/A 0.348 0.576 0.811 3e-17
Q5RBF992 60S ribosomal protein L37 no N/A 0.348 0.576 0.811 3e-17
P6151492 60S ribosomal protein L37 no N/A 0.348 0.576 0.811 3e-17
P6151392 60S ribosomal protein L37 no N/A 0.348 0.576 0.811 3e-17
Q3MIC092 60S ribosomal protein L37 no N/A 0.348 0.576 0.811 3e-17
>sp|Q568K5|NAA40_DANRE N-alpha-acetyltransferase 40 OS=Danio rerio GN=naa40 PE=2 SV=1 Back     alignment and function desciption
 Score =  112 bits (279), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (71%), Gaps = 1/103 (0%)

Query: 45  EYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSS 104
           E K+ T L  +T +W +EL   NM+  YE  + GW  + K  EM D+RA YL+A++ + S
Sbjct: 58  ECKRVTALSPDTVEWAYELTRANMQTLYEQSEWGWKEREKREEMKDERAWYLLARD-ADS 116

Query: 105 TPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAF 147
           TP+AFSHFRFDV+ G+ VLYCYE+QLE +V+RKGLGKF++Q  
Sbjct: 117 TPLAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQIL 159

Danio rerio (taxid: 7955)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: -
>sp|Q86UY6|NAA40_HUMAN N-alpha-acetyltransferase 40 OS=Homo sapiens GN=NAA40 PE=2 SV=1 Back     alignment and function description
>sp|Q8VE10|NAA40_MOUSE N-alpha-acetyltransferase 40 OS=Mus musculus GN=Naa40 PE=2 SV=1 Back     alignment and function description
>sp|Q6NUH2|NAA40_XENLA N-alpha-acetyltransferase 40 OS=Xenopus laevis GN=naa40 PE=2 SV=1 Back     alignment and function description
>sp|Q9VMU4|RL37A_DROME 60S ribosomal protein L37a OS=Drosophila melanogaster GN=RpL37A PE=1 SV=3 Back     alignment and function description
>sp|P61515|RL37P_RAT Putative 60S ribosomal protein L37a OS=Rattus norvegicus GN=Rpl37a-ps1 PE=5 SV=2 Back     alignment and function description
>sp|Q5RBF9|RL37A_PONAB 60S ribosomal protein L37a OS=Pongo abelii GN=RPL37A PE=3 SV=3 Back     alignment and function description
>sp|P61514|RL37A_MOUSE 60S ribosomal protein L37a OS=Mus musculus GN=Rpl37a PE=2 SV=2 Back     alignment and function description
>sp|P61513|RL37A_HUMAN 60S ribosomal protein L37a OS=Homo sapiens GN=RPL37A PE=1 SV=2 Back     alignment and function description
>sp|Q3MIC0|RL37A_BOVIN 60S ribosomal protein L37a OS=Bos taurus GN=RPL37A PE=3 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
91094099251 PREDICTED: similar to predicted protein 0.657 0.398 0.534 3e-23
62955241237 N-alpha-acetyltransferase 40 [Danio reri 0.671 0.430 0.524 7e-23
348529900239 PREDICTED: N-alpha-acetyltransferase 40, 0.657 0.418 0.534 1e-22
291238219240 PREDICTED: N-acetyltransferase 11-like [ 0.671 0.425 0.524 2e-22
432920062237 PREDICTED: N-alpha-acetyltransferase 40- 0.671 0.430 0.514 2e-22
410929173239 PREDICTED: N-alpha-acetyltransferase 40- 0.657 0.418 0.534 2e-22
47215724237 unnamed protein product [Tetraodon nigro 0.657 0.421 0.524 5e-22
345783753 264 PREDICTED: N-alpha-acetyltransferase 40 0.671 0.386 0.533 6e-22
348564730237 PREDICTED: N-alpha-acetyltransferase 40, 0.671 0.430 0.533 7e-22
301762684242 PREDICTED: n-alpha-acetyltransferase 40, 0.671 0.421 0.533 8e-22
>gi|91094099|ref|XP_967118.1| PREDICTED: similar to predicted protein [Tribolium castaneum] gi|270010877|gb|EFA07325.1| hypothetical protein TcasGA2_TC015921 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 1/101 (0%)

Query: 47  KKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSSTP 106
           ++ TDL   TK W++ L ++NM+  YE C  GW+   K  E+ D+ A YL+AK G   T 
Sbjct: 61  QRVTDLDESTKSWIFNLTKRNMQLKYEQCSWGWNDNKKMEELMDEAAWYLIAK-GVDGTF 119

Query: 107 VAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQAF 147
           + FSHFRFD+D G  VLYCYELQLE  +QRKGLGKFMMQ  
Sbjct: 120 LGFSHFRFDMDEGIEVLYCYELQLEPAIQRKGLGKFMMQIL 160

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|62955241|ref|NP_001017632.1| N-alpha-acetyltransferase 40 [Danio rerio] gi|82229995|sp|Q568K5.1|NAA40_DANRE RecName: Full=N-alpha-acetyltransferase 40; AltName: Full=N-acetyltransferase 11; AltName: Full=NatD catalytic subunit gi|62203338|gb|AAH92819.1| N-acetyltransferase 11 [Danio rerio] Back     alignment and taxonomy information
>gi|348529900|ref|XP_003452450.1| PREDICTED: N-alpha-acetyltransferase 40, NatD catalytic subunit-like [Oreochromis niloticus] Back     alignment and taxonomy information
>gi|291238219|ref|XP_002739028.1| PREDICTED: N-acetyltransferase 11-like [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|432920062|ref|XP_004079819.1| PREDICTED: N-alpha-acetyltransferase 40-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|410929173|ref|XP_003977974.1| PREDICTED: N-alpha-acetyltransferase 40-like [Takifugu rubripes] Back     alignment and taxonomy information
>gi|47215724|emb|CAG05735.1| unnamed protein product [Tetraodon nigroviridis] Back     alignment and taxonomy information
>gi|345783753|ref|XP_533250.3| PREDICTED: N-alpha-acetyltransferase 40 [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|348564730|ref|XP_003468157.1| PREDICTED: N-alpha-acetyltransferase 40, NatD catalytic subunit-like [Cavia porcellus] Back     alignment and taxonomy information
>gi|301762684|ref|XP_002916767.1| PREDICTED: n-alpha-acetyltransferase 40, NatD catalytic subunit-like [Ailuropoda melanoleuca] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query152
ZFIN|ZDB-GENE-050417-105237 naa40 "N(alpha)-acetyltransfer 0.657 0.421 0.534 7.6e-25
UNIPROTKB|F1PFC2231 NAA40 "Uncharacterized protein 0.657 0.432 0.544 3.3e-24
UNIPROTKB|F1RPY9238 NAA40 "Uncharacterized protein 0.657 0.420 0.534 4.2e-24
UNIPROTKB|B4DR03216 NAA40 "cDNA FLJ58929" [Homo sa 0.657 0.462 0.534 6.8e-24
UNIPROTKB|B4DU10197 NAA40 "N-alpha-acetyltransfera 0.657 0.507 0.534 6.8e-24
UNIPROTKB|Q86UY6237 NAA40 "N-alpha-acetyltransfera 0.657 0.421 0.534 6.8e-24
MGI|MGI:1918249237 Naa40 "N(alpha)-acetyltransfer 0.657 0.421 0.534 8.7e-24
UNIPROTKB|A5PKK1237 NAT11 "Uncharacterized protein 0.657 0.421 0.524 1.8e-23
RGD|1565838237 Naa40 "N(alpha)-acetyltransfer 0.657 0.421 0.524 1.8e-23
UNIPROTKB|H9L055234 NAA40 "Uncharacterized protein 0.657 0.427 0.504 4.8e-23
ZFIN|ZDB-GENE-050417-105 naa40 "N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 283 (104.7 bits), Expect = 7.6e-25, P = 7.6e-25
 Identities = 54/101 (53%), Positives = 74/101 (73%)

Query:    45 EYKKSTDLGAETKKWVWELEEKNMKHSYEVCDIGWDPQGKHSEMFDDRACYLVAKNGSSS 104
             E K+ T L  +T +W +EL   NM+  YE  + GW  + K  EM D+RA YL+A++ + S
Sbjct:    58 ECKRVTALSPDTVEWAYELTRANMQTLYEQSEWGWKEREKREEMKDERAWYLLARD-ADS 116

Query:   105 TPVAFSHFRFDVDFGEPVLYCYELQLEKQVQRKGLGKFMMQ 145
             TP+AFSHFRFDV+ G+ VLYCYE+QLE +V+RKGLGKF++Q
Sbjct:   117 TPLAFSHFRFDVECGDEVLYCYEVQLESKVRRKGLGKFLIQ 157
GO:0008080 "N-acetyltransferase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0016740 "transferase activity" evidence=IEA
GO:0016746 "transferase activity, transferring acyl groups" evidence=IEA
UNIPROTKB|F1PFC2 NAA40 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RPY9 NAA40 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|B4DR03 NAA40 "cDNA FLJ58929" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DU10 NAA40 "N-alpha-acetyltransferase 40" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q86UY6 NAA40 "N-alpha-acetyltransferase 40" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1918249 Naa40 "N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|A5PKK1 NAT11 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1565838 Naa40 "N(alpha)-acetyltransferase 40, NatD catalytic subunit, homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H9L055 NAA40 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A4S6Z4RL37A_OSTLUNo assigned EC number0.79540.28940.4782yesN/A
Q8VE10NAA40_MOUSE2, ., 3, ., 1, ., -0.52420.67100.4303yesN/A
O26777RL37A_METTHNo assigned EC number0.51280.25650.4382yesN/A
Q9U2A8RL37A_CAEELNo assigned EC number0.75470.34860.5824yesN/A
Q5QM99RL37A_ORYSJNo assigned EC number0.67920.34860.5760yesN/A
Q8RXU5R37A2_ARATHNo assigned EC number0.79540.28940.4782yesN/A
O96184RL37A_PLAF7No assigned EC number0.67920.34860.5520yesN/A
P0CX25RL43A_YEASTNo assigned EC number0.71690.34860.5760yesN/A
P0CX26RL43B_YEASTNo assigned EC number0.71690.34860.5760yesN/A
P54051RL37A_METJANo assigned EC number0.51280.25650.4239yesN/A
Q00VK4RL37A_OSTTANo assigned EC number0.79540.28940.4782yesN/A
Q86UY6NAA40_HUMAN2, ., 3, ., 1, ., -0.52420.67100.4303yesN/A
Q9VMU4RL37A_DROMENo assigned EC number0.83010.34860.5760yesN/A
Q568K5NAA40_DANRE2, ., 3, ., 1, ., -0.52420.67100.4303yesN/A
Q6FRG6RL43_CANGANo assigned EC number0.77770.29600.4891yesN/A
Q9HGL8RL43A_SCHPONo assigned EC number0.62260.34860.5638yesN/A
Q54UG4RL37A_DICDINo assigned EC number0.75470.34860.5824yesN/A
Q74N55RL37A_NANEQNo assigned EC number0.55260.250.4418yesN/A
Q751L1RL43_ASHGONo assigned EC number0.69810.34860.5760yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
PTZ0025590 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Pr 1e-27
pfam0178090 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protei 9e-26
TIGR0028092 TIGR00280, L37a, ribosomal protein L37a 2e-16
PRK0397690 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Re 9e-16
COG199789 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Tra 6e-15
>gnl|CDD|240332 PTZ00255, PTZ00255, 60S ribosomal protein L37a; Provisional Back     alignment and domain information 
 Score = 97.9 bits (244), Expect = 1e-27
 Identities = 40/53 (75%), Positives = 44/53 (83%)

Query: 1  MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLG 53
          MAKRTKKVGITGKYGTRYGASLRK +KK+EI+QHAKY C FCGK   K   +G
Sbjct: 1  MAKRTKKVGITGKYGTRYGASLRKQIKKIEISQHAKYFCPFCGKHAVKRQAVG 53

Length = 90
>gnl|CDD|216695 pfam01780, Ribosomal_L37ae, Ribosomal L37ae protein family Back     alignment and domain information
>gnl|CDD|232904 TIGR00280, L37a, ribosomal protein L37a Back     alignment and domain information
>gnl|CDD|235183 PRK03976, rpl37ae, 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>gnl|CDD|224908 COG1997, RPL43A, Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 152
KOG0402|consensus92 99.92
PTZ0025590 60S ribosomal protein L37a; Provisional 99.91
PRK0397690 rpl37ae 50S ribosomal protein L37Ae; Reviewed 99.9
TIGR0028091 L37a ribosomal protein L37a. This model finds euka 99.89
KOG2488|consensus202 99.88
PF0178090 Ribosomal_L37ae: Ribosomal L37ae protein family; I 99.88
COG199789 RPL43A Ribosomal protein L37AE/L43A [Translation, 99.84
PRK10146144 aminoalkylphosphonic acid N-acetyltransferase; Pro 99.34
KOG3216|consensus163 99.31
PHA00673154 acetyltransferase domain containing protein 99.25
PF13673117 Acetyltransf_10: Acetyltransferase (GNAT) domain; 99.23
TIGR03827266 GNAT_ablB putative beta-lysine N-acetyltransferase 99.18
PRK10314153 putative acyltransferase; Provisional 99.14
TIGR01575131 rimI ribosomal-protein-alanine acetyltransferase. 99.09
PHA01807153 hypothetical protein 99.08
PTZ00330147 acetyltransferase; Provisional 99.08
PRK07757152 acetyltransferase; Provisional 99.04
TIGR03448 292 mycothiol_MshD mycothiol biosynthesis acetyltransf 99.03
PRK09831147 putative acyltransferase; Provisional 99.03
TIGR02406157 ectoine_EctA L-2,4-diaminobutyric acid acetyltrans 99.03
PRK03624140 putative acetyltransferase; Provisional 99.0
PF0058383 Acetyltransf_1: Acetyltransferase (GNAT) family; I 99.0
PRK09491146 rimI ribosomal-protein-alanine N-acetyltransferase 98.98
TIGR01890429 N-Ac-Glu-synth amino-acid N-acetyltransferase. Thi 98.98
PF1350879 Acetyltransf_7: Acetyltransferase (GNAT) domain; P 98.96
PLN02706150 glucosamine 6-phosphate N-acetyltransferase 98.94
PRK07922169 N-acetylglutamate synthase; Validated 98.93
PF13527127 Acetyltransf_9: Acetyltransferase (GNAT) domain; P 98.93
PRK05279441 N-acetylglutamate synthase; Validated 98.93
PRK10140162 putative acetyltransferase YhhY; Provisional 98.93
PLN02825515 amino-acid N-acetyltransferase 98.92
TIGR03103 547 trio_acet_GNAT GNAT-family acetyltransferase TIGR0 98.92
PRK10514145 putative acetyltransferase; Provisional 98.91
COG0456177 RimI Acetyltransferases [General function predicti 98.85
PRK12308614 bifunctional argininosuccinate lyase/N-acetylgluta 98.78
TIGR01686320 FkbH FkbH-like domain. The C-terminal portion of t 98.77
COG1247169 Sortase and related acyltransferases [Cell envelop 98.74
TIGR02382191 wecD_rffC TDP-D-fucosamine acetyltransferase. This 98.73
PRK10975194 TDP-fucosamine acetyltransferase; Provisional 98.7
COG3153171 Predicted acetyltransferase [General function pred 98.69
PRK01346 411 hypothetical protein; Provisional 98.68
cd0430165 NAT_SF N-Acyltransferase superfamily: Various enzy 98.67
PRK13688156 hypothetical protein; Provisional 98.65
PF13523152 Acetyltransf_8: Acetyltransferase (GNAT) domain; P 98.62
PRK10562145 putative acetyltransferase; Provisional 98.61
KOG3139|consensus165 98.58
COG1246153 ArgA N-acetylglutamate synthase and related acetyl 98.54
PF13420155 Acetyltransf_4: Acetyltransferase (GNAT) domain; P 98.54
TIGR03448292 mycothiol_MshD mycothiol biosynthesis acetyltransf 98.54
TIGR03585156 PseH pseudaminic acid biosynthesis N-acetyl transf 98.47
PRK15130186 spermidine N1-acetyltransferase; Provisional 98.43
PRK10809194 ribosomal-protein-S5-alanine N-acetyltransferase; 98.36
PF13302142 Acetyltransf_3: Acetyltransferase (GNAT) domain; P 98.25
PF1454278 Acetyltransf_CG: GCN5-related N-acetyl-transferase 98.24
PRK10151179 ribosomal-protein-L7/L12-serine acetyltransferase; 98.23
cd02169 297 Citrate_lyase_ligase Citrate lyase ligase. Citrate 98.15
KOG3396|consensus150 98.03
COG2153155 ElaA Predicted acyltransferase [General function p 98.01
PF13718196 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2Z 97.9
COG238899 Predicted acetyltransferase [General function pred 97.9
KOG3397|consensus 225 97.9
TIGR00124 332 cit_ly_ligase [citrate (pro-3S)-lyase] ligase. ATP 97.87
PF12568128 DUF3749: Acetyltransferase (GNAT) domain; InterPro 97.78
KOG3235|consensus193 97.77
TIGR01211522 ELP3 histone acetyltransferase, ELP3 family. The S 97.66
PF0844586 FR47: FR47-like protein; InterPro: IPR013653 Prote 97.61
KOG3234|consensus173 97.55
COG1444 758 Predicted P-loop ATPase fused to an acetyltransfer 97.4
PF13480142 Acetyltransf_6: Acetyltransferase (GNAT) domain 97.29
COG0454156 WecD Histone acetyltransferase HPA2 and related ac 97.23
PF05301120 Mec-17: Touch receptor neuron protein Mec-17; Inte 97.1
PF01233162 NMT: Myristoyl-CoA:protein N-myristoyltransferase, 96.89
PF01853188 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz i 96.82
COG3981174 Predicted acetyltransferase [General function pred 96.74
PF1388070 Acetyltransf_13: ESCO1/2 acetyl-transferase 96.51
PLN03238 290 probable histone acetyltransferase MYST; Provision 96.42
KOG3138|consensus187 96.4
PLN03239 351 histone acetyltransferase; Provisional 96.05
COG1670187 RimL Acetyltransferases, including N-acetylases of 95.99
COG3393268 Predicted acetyltransferase [General function pred 95.97
PF12746265 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S 95.9
PF06852181 DUF1248: Protein of unknown function (DUF1248); In 95.86
PLN00104 450 MYST -like histone acetyltransferase; Provisional 95.83
PTZ00064 552 histone acetyltransferase; Provisional 95.81
KOG4601|consensus 264 95.63
TIGR03694241 exosort_acyl putative PEP-CTERM/exosortase system- 95.29
PRK13834207 putative autoinducer synthesis protein; Provisiona 95.2
COG5628143 Predicted acetyltransferase [General function pred 95.04
PF00765182 Autoind_synth: Autoinducer synthetase; InterPro: I 94.79
KOG2747|consensus 396 94.76
cd0426499 DUF619-NAGS DUF619 domain of various N-acetylgluta 94.39
COG5630495 ARG2 Acetylglutamate synthase [Amino acid transpor 94.38
TIGR03243 335 arg_catab_AOST arginine and ornithine succinyltran 93.35
KOG2779|consensus 421 93.34
TIGR03244 336 arg_catab_AstA arginine N-succinyltransferase. In 93.31
PF13444101 Acetyltransf_5: Acetyltransferase (GNAT) domain 93.07
PRK10456 344 arginine succinyltransferase; Provisional 93.0
PF0844489 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acylt 92.21
PF04958 342 AstA: Arginine N-succinyltransferase beta subunit; 91.62
TIGR03245 336 arg_AOST_alph arginine/ornithine succinyltransfera 91.51
cd0426599 DUF619-NAGS-U DUF619 domain of various N-acetylglu 91.43
COG3053 352 CitC Citrate lyase synthetase [Energy production a 91.28
COG3375 266 Uncharacterized conserved protein [Function unknow 91.04
COG5027 395 SAS2 Histone acetyltransferase (MYST family) [Chro 91.0
KOG4144|consensus190 90.98
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 90.91
KOG2696|consensus 403 89.85
PF04768170 DUF619: Protein of unknown function (DUF619); Inte 89.68
PF09924299 DUF2156: Uncharacterized conserved protein (DUF215 89.07
COG3818167 Predicted acetyltransferase, GNAT superfamily [Gen 88.68
KOG2036|consensus 1011 88.07
COG4888104 Uncharacterized Zn ribbon-containing protein [Gene 86.45
COG5092 451 NMT1 N-myristoyl transferase [Lipid metabolism] 84.45
PF0775424 DUF1610: Domain of unknown function (DUF1610); Int 84.16
KOG4135|consensus185 83.9
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 83.86
PHA0061644 hypothetical protein 83.14
COG3138 336 AstA Arginine/ornithine N-succinyltransferase beta 82.7
>KOG0402|consensus Back     alignment and domain information 
Probab=99.92  E-value=3.2e-26  Score=148.73  Aligned_cols=45  Identities=91%  Similarity=1.418  Sum_probs=44.6

Q ss_pred             CCCccceeeeccccccccchhHhHhHHhhhhhcccccccCCCCcc
Q psy838            1 MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKE   45 (152)
Q Consensus         1 m~~~~~~~~~~~~~g~ryg~~~rk~~~~~~~~~~~~~~c~~c~~~   45 (152)
                      |++|||||||+|+||+|||++|||++++||++||++|+|+||||.
T Consensus         1 m~krtKKVgI~gkyGtrYGaSLrk~vKkiei~Qhaky~CsfCGK~   45 (92)
T KOG0402|consen    1 MAKRTKKVGIVGKYGTRYGASLRKMVKKIEIQQHAKYTCSFCGKK   45 (92)
T ss_pred             CCcccceeeeeecccchhhHHHHHHHHHHHHHHhhhhhhhhcchh
Confidence            999999999999999999999999999999999999999999998

>PTZ00255 60S ribosomal protein L37a; Provisional Back     alignment and domain information
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed Back     alignment and domain information
>TIGR00280 L37a ribosomal protein L37a Back     alignment and domain information
>KOG2488|consensus Back     alignment and domain information
>PF01780 Ribosomal_L37ae: Ribosomal L37ae protein family; InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10146 aminoalkylphosphonic acid N-acetyltransferase; Provisional Back     alignment and domain information
>KOG3216|consensus Back     alignment and domain information
>PHA00673 acetyltransferase domain containing protein Back     alignment and domain information
>PF13673 Acetyltransf_10: Acetyltransferase (GNAT) domain; PDB: 2FIW_A 1BOB_A 3FNC_B 3EXN_A Back     alignment and domain information
>TIGR03827 GNAT_ablB putative beta-lysine N-acetyltransferase Back     alignment and domain information
>PRK10314 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR01575 rimI ribosomal-protein-alanine acetyltransferase Back     alignment and domain information
>PHA01807 hypothetical protein Back     alignment and domain information
>PTZ00330 acetyltransferase; Provisional Back     alignment and domain information
>PRK07757 acetyltransferase; Provisional Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>PRK09831 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR02406 ectoine_EctA L-2,4-diaminobutyric acid acetyltransferase Back     alignment and domain information
>PRK03624 putative acetyltransferase; Provisional Back     alignment and domain information
>PF00583 Acetyltransf_1: Acetyltransferase (GNAT) family; InterPro: IPR000182 The N-acetyltransferases (NAT) (EC 2 Back     alignment and domain information
>PRK09491 rimI ribosomal-protein-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01890 N-Ac-Glu-synth amino-acid N-acetyltransferase Back     alignment and domain information
>PF13508 Acetyltransf_7: Acetyltransferase (GNAT) domain; PDB: 3EY5_A 3FRM_B 3D8P_B 3GY9_A 3GYA_A 3S6F_A 2Q7B_A 1CM0_B 1XEB_B 1Y7R_A Back     alignment and domain information
>PLN02706 glucosamine 6-phosphate N-acetyltransferase Back     alignment and domain information
>PRK07922 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PF13527 Acetyltransf_9: Acetyltransferase (GNAT) domain; PDB: 3SXN_C 2I00_D 1M4D_B 1M44_A 1M4G_B 1M4I_A 2OZG_A 2HV2_F 3N7Z_A 3RYO_B Back     alignment and domain information
>PRK05279 N-acetylglutamate synthase; Validated Back     alignment and domain information
>PRK10140 putative acetyltransferase YhhY; Provisional Back     alignment and domain information
>PLN02825 amino-acid N-acetyltransferase Back     alignment and domain information
>TIGR03103 trio_acet_GNAT GNAT-family acetyltransferase TIGR03103 Back     alignment and domain information
>PRK10514 putative acetyltransferase; Provisional Back     alignment and domain information
>COG0456 RimI Acetyltransferases [General function prediction only] Back     alignment and domain information
>PRK12308 bifunctional argininosuccinate lyase/N-acetylglutamate synthase; Provisional Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>COG1247 Sortase and related acyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02382 wecD_rffC TDP-D-fucosamine acetyltransferase Back     alignment and domain information
>PRK10975 TDP-fucosamine acetyltransferase; Provisional Back     alignment and domain information
>COG3153 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK01346 hypothetical protein; Provisional Back     alignment and domain information
>cd04301 NAT_SF N-Acyltransferase superfamily: Various enzymes that characteristically catalyze the transfer of an acyl group to a substrate Back     alignment and domain information
>PRK13688 hypothetical protein; Provisional Back     alignment and domain information
>PF13523 Acetyltransf_8: Acetyltransferase (GNAT) domain; PDB: 2VQY_A 2BUE_A 1V0C_A 1YK3_D 2PR8_A 2QIR_A 2PRB_A 2QML_A 2PC1_A Back     alignment and domain information
>PRK10562 putative acetyltransferase; Provisional Back     alignment and domain information
>KOG3139|consensus Back     alignment and domain information
>COG1246 ArgA N-acetylglutamate synthase and related acetyltransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PF13420 Acetyltransf_4: Acetyltransferase (GNAT) domain; PDB: 3DR8_A 3DR6_A 2AE6_B 2JLM_C 2J8R_A 1YVO_B 2J8M_A 2J8N_A 2BL1_A 3IWG_A Back     alignment and domain information
>TIGR03448 mycothiol_MshD mycothiol biosynthesis acetyltransferase Back     alignment and domain information
>TIGR03585 PseH pseudaminic acid biosynthesis N-acetyl transferase Back     alignment and domain information
>PRK15130 spermidine N1-acetyltransferase; Provisional Back     alignment and domain information
>PRK10809 ribosomal-protein-S5-alanine N-acetyltransferase; Provisional Back     alignment and domain information
>PF13302 Acetyltransf_3: Acetyltransferase (GNAT) domain; PDB: 3TTH_C 3JUW_A 2ZXV_A 2Z0Z_A 2VI7_B 3EG7_F 1YRE_C 3IGR_B 3FBU_A 2FCK_A Back     alignment and domain information
>PF14542 Acetyltransf_CG: GCN5-related N-acetyl-transferase; PDB: 2H5M_A 2Q44_A 1XMT_A 2Q4Y_A 2IL4_A 2EVN_A 1R57_A Back     alignment and domain information
>PRK10151 ribosomal-protein-L7/L12-serine acetyltransferase; Provisional Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase Back     alignment and domain information
>KOG3396|consensus Back     alignment and domain information
>COG2153 ElaA Predicted acyltransferase [General function prediction only] Back     alignment and domain information
>PF13718 GNAT_acetyltr_2: GNAT acetyltransferase 2; PDB: 2ZPA_B Back     alignment and domain information
>COG2388 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>KOG3397|consensus Back     alignment and domain information
>TIGR00124 cit_ly_ligase [citrate (pro-3S)-lyase] ligase Back     alignment and domain information
>PF12568 DUF3749: Acetyltransferase (GNAT) domain; InterPro: IPR024612 This domain is found in uncharacterised proteins from Gammaproteobacteria, and is approximately 40 amino acids in length Back     alignment and domain information
>KOG3235|consensus Back     alignment and domain information
>TIGR01211 ELP3 histone acetyltransferase, ELP3 family Back     alignment and domain information
>PF08445 FR47: FR47-like protein; InterPro: IPR013653 Proteins in this entry have a conserved region similar to the C-terminal region of the Drosophila melanogaster (Fruit fly) hypothetical protein FR47 (Q9VR51 from SWISSPROT) Back     alignment and domain information
>KOG3234|consensus Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13480 Acetyltransf_6: Acetyltransferase (GNAT) domain Back     alignment and domain information
>COG0454 WecD Histone acetyltransferase HPA2 and related acetyltransferases [Transcription / General function prediction only] Back     alignment and domain information
>PF05301 Mec-17: Touch receptor neuron protein Mec-17; InterPro: IPR007965 Mec-17 is the protein product of one of the 18 genes required for the development and function of the touch receptor neuron for gentle touch Back     alignment and domain information
>PF01233 NMT: Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain; InterPro: IPR022676 Myristoyl-CoA:protein N-myristoyltransferase (2 Back     alignment and domain information
>PF01853 MOZ_SAS: MOZ/SAS family; InterPro: IPR002717 Moz is a monocytic leukemia Zn_finger protein and the SAS protein from Saccharomyces cerevisiae (Baker's yeast) is involved in silencing the Hmr locus Back     alignment and domain information
>COG3981 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF13880 Acetyltransf_13: ESCO1/2 acetyl-transferase Back     alignment and domain information
>PLN03238 probable histone acetyltransferase MYST; Provisional Back     alignment and domain information
>KOG3138|consensus Back     alignment and domain information
>PLN03239 histone acetyltransferase; Provisional Back     alignment and domain information
>COG1670 RimL Acetyltransferases, including N-acetylases of ribosomal proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3393 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF12746 GNAT_acetyltran: GNAT acetyltransferase; PDB: 3G3S_B Back     alignment and domain information
>PF06852 DUF1248: Protein of unknown function (DUF1248); InterPro: IPR009658 This entry represents a conserved region within a number of proteins of unknown function that seem to be specific to Caenorhabditis elegans Back     alignment and domain information
>PLN00104 MYST -like histone acetyltransferase; Provisional Back     alignment and domain information
>PTZ00064 histone acetyltransferase; Provisional Back     alignment and domain information
>KOG4601|consensus Back     alignment and domain information
>TIGR03694 exosort_acyl putative PEP-CTERM/exosortase system-associated acyltransferase Back     alignment and domain information
>PRK13834 putative autoinducer synthesis protein; Provisional Back     alignment and domain information
>COG5628 Predicted acetyltransferase [General function prediction only] Back     alignment and domain information
>PF00765 Autoind_synth: Autoinducer synthetase; InterPro: IPR001690 Bacterial species have many methods of controlling gene expression and cell growth Back     alignment and domain information
>KOG2747|consensus Back     alignment and domain information
>cd04264 DUF619-NAGS DUF619 domain of various N-acetylglutamate Synthases of the fungal arginine-biosynthetic pathway and urea cycle found in humans and fish Back     alignment and domain information
>COG5630 ARG2 Acetylglutamate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03243 arg_catab_AOST arginine and ornithine succinyltransferase subunits Back     alignment and domain information
>KOG2779|consensus Back     alignment and domain information
>TIGR03244 arg_catab_AstA arginine N-succinyltransferase Back     alignment and domain information
>PF13444 Acetyltransf_5: Acetyltransferase (GNAT) domain Back     alignment and domain information
>PRK10456 arginine succinyltransferase; Provisional Back     alignment and domain information
>PF08444 Gly_acyl_tr_C: Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region; InterPro: IPR013652 This entry represents mammalian-specific glycine N-acyltransferase (also called aralkyl acyl-CoA:amino acid N-acyltransferase; 2 Back     alignment and domain information
>PF04958 AstA: Arginine N-succinyltransferase beta subunit; InterPro: IPR007041 Arginine N-succinyltransferase catalyses the transfer of succinyl-CoA to arginine to produce succinylarginine Back     alignment and domain information
>TIGR03245 arg_AOST_alph arginine/ornithine succinyltransferase, alpha subunit Back     alignment and domain information
>cd04265 DUF619-NAGS-U DUF619 domain of various N-acetylglutamate Synthases (NAGS) of the urea (U) cycle of humans and fish Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>COG3375 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5027 SAS2 Histone acetyltransferase (MYST family) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4144|consensus Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>KOG2696|consensus Back     alignment and domain information
>PF04768 DUF619: Protein of unknown function (DUF619); InterPro: IPR006855 This region of unknown function is found at the C terminus of Neurospora crassa acetylglutamate synthase (2 Back     alignment and domain information
>PF09924 DUF2156: Uncharacterized conserved protein (DUF2156); InterPro: IPR024320 This domain of unknown function is found in uncharacterised proteins and in Lysylphosphatidylglycerol synthetase, which catalyses the transfer of a lysyl group from L-lysyl-tRNA(Lys) to membrane-bound phosphatidylglycerol [] Back     alignment and domain information
>COG3818 Predicted acetyltransferase, GNAT superfamily [General function prediction only] Back     alignment and domain information
>KOG2036|consensus Back     alignment and domain information
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only] Back     alignment and domain information
>COG5092 NMT1 N-myristoyl transferase [Lipid metabolism] Back     alignment and domain information
>PF07754 DUF1610: Domain of unknown function (DUF1610); InterPro: IPR011668 This domain is found in archaeal species Back     alignment and domain information
>KOG4135|consensus Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>COG3138 AstA Arginine/ornithine N-succinyltransferase beta subunit [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
2zkr_z92 Structure Of A Mammalian Ribosomal 60s Subunit With 3e-18
4a17_Y103 T.Thermophila 60s Ribosomal Subunit In Complex With 6e-16
3izs_m92 Localization Of The Large Subunit Ribosomal Protein 9e-16
1s1i_991 Structure Of The Ribosomal 80s-Eef2-Sordarin Comple 4e-15
3izr_m92 Localization Of The Large Subunit Ribosomal Protein 2e-14
3zf7_o93 High-resolution Cryo-electron Microscopy Structure 2e-11
1ysh_D73 Localization And Dynamic Behavior Of Ribosomal Prot 1e-10
3jyw_972 Structure Of The 60s Proteins For Eukaryotic Riboso 3e-10
3j21_i83 Promiscuous Behavior Of Proteins In Archaeal Riboso 2e-05
>pdb|2ZKR|ZZ Chain z, Structure Of A Mammalian Ribosomal 60s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 46/53 (86%)
Query: 1  MAKRTKKVGITGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKEYKKSTDLG 53
          MAKRTKKVGI GKYGTRYGASLRKMVKK+EI+QHAKYTCSFCGK   K   +G
Sbjct: 1  MAKRTKKVGIVGKYGTRYGASLRKMVKKIEISQHAKYTCSFCGKTKMKRRAVG 53
>pdb|4A17|Y Chain Y, T.Thermophila 60s Ribosomal Subunit In Complex With Initiation Factor 6. This File Contains 5s Rrna, 5.8s Rrna And Proteins Of Molecule 2. Length = 103 Back     alignment and structure
>pdb|3IZS|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 92 Back     alignment and structure
>pdb|1S1I|9 Chain 9, Structure Of The Ribosomal 80s-Eef2-Sordarin Complex From Yeast Obtained By Docking Atomic Models For Rna And Protein Components Into A 11.7 A Cryo-Em Map. This File, 1s1i, Contains 60s Subunit. The 40s Ribosomal Subunit Is In File 1s1h Length = 91 Back     alignment and structure
>pdb|3IZR|MM Chain m, Localization Of The Large Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 92 Back     alignment and structure
>pdb|3ZF7|OO Chain o, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 93 Back     alignment and structure
>pdb|1YSH|D Chain D, Localization And Dynamic Behavior Of Ribosomal Protein L30e Length = 73 Back     alignment and structure
>pdb|3JYW|9 Chain 9, Structure Of The 60s Proteins For Eukaryotic Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 72 Back     alignment and structure
>pdb|3J21|II Chain i, Promiscuous Behavior Of Proteins In Archaeal Ribosomes Revealed By Cryo-em: Implications For Evolution Of Eukaryotic Ribosomes (50s Ribosomal Proteins) Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query152
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 1e-22
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 1e-22
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 2e-22
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 2e-22
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 5e-16
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 1e-15
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 3e-15
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Length = 103 Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Length = 116 Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Length = 83 Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Length = 72 Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Length = 73 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
3iz5_m92 60S ribosomal protein L43 (L37AE); eukaryotic ribo 99.92
3izc_m92 60S ribosomal protein RPL43 (L37AE); eukaryotic ri 99.91
4a17_Y103 RPL37A, 60S ribosomal protein L32; eukaryotic ribo 99.91
3j21_i83 50S ribosomal protein L37AE; archaea, archaeal, KI 99.91
3cc2_Z116 50S ribosomal protein L37AE, 50S ribosomal protein 99.89
1ffk_W73 Ribosomal protein L37AE; ribosome assembly, RNA-RN 99.76
3jyw_972 60S ribosomal protein L43; eukaryotic ribosome, RA 99.75
1vq8_Z83 50S ribosomal protein L37AE; ribosome 50S, protein 99.67
1tiq_A180 Protease synthase and sporulation negative regulat 99.45
4e0a_A164 BH1408 protein; structural genomics, PSI-biology, 99.41
1cjw_A166 Protein (serotonin N-acetyltransferase); HET: COT; 99.41
3e0k_A150 Amino-acid acetyltransferase; N-acetylglutamate sy 99.4
2bei_A170 Diamine acetyltransferase 2; SSAT2, BC011751, AAH1 99.37
2dxq_A150 AGR_C_4057P, acetyltransferase; structural genomic 99.37
2fe7_A166 Probable N-acetyltransferase; structural genomics, 99.37
3efa_A147 Putative acetyltransferase; structural genom 2, pr 99.36
1kux_A207 Aralkylamine, serotonin N-acetyltransferase; enzym 99.35
3t9y_A150 Acetyltransferase, GNAT family; PSI-biology, struc 99.35
2ree_A224 CURA; GNAT, S-acetyltransferase, decarboxylase, po 99.35
1vkc_A158 Putative acetyl transferase; structural genomics, 99.34
3fyn_A176 Integron gene cassette protein HFX_CASS3; integron 99.33
3gy9_A150 GCN5-related N-acetyltransferase; YP_001815201.1, 99.33
2ob0_A170 Human MAK3 homolog; acetyltransferase, structural 99.33
2q0y_A153 GCN5-related N-acetyltransferase; YP_295895.1, ace 99.33
2x7b_A168 N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulf 99.33
3fnc_A163 Protein LIN0611, putative acetyltransferase; GNAT, 99.33
1xeb_A150 Hypothetical protein PA0115; midwest center for st 99.32
4h89_A173 GCN5-related N-acetyltransferase; N-acyltransferas 99.31
3jvn_A166 Acetyltransferase; alpha-beta protein, structural 99.31
3mgd_A157 Predicted acetyltransferase; structural genomics, 99.31
1qsm_A152 HPA2 histone acetyltransferase; protein-acetyl coe 99.3
3dsb_A157 Putative acetyltransferase; APC60368.2, ST genomic 99.3
3i9s_A183 Integron cassette protein; oyster POND, woods HOLE 99.29
3fix_A183 N-acetyltransferase; termoplasma acidophilum, stru 99.29
1q2y_A140 Protein YJCF, similar to hypothetical proteins; GC 99.29
4evy_A166 Aminoglycoside N(6')-acetyltransferase type 1; cen 99.29
3d8p_A163 Acetyltransferase of GNAT family; NP_373092.1, str 99.29
1u6m_A199 Acetyltransferase, GNAT family; structural genomic 99.29
1ufh_A180 YYCN protein; alpha and beta, fold, acetyltransfer 99.29
3kkw_A182 Putative uncharacterized protein; acetyltransferas 99.28
3bln_A143 Acetyltransferase GNAT family; NP_981174.1, struct 99.28
2aj6_A159 Hypothetical protein MW0638; structural genomics, 99.28
2fia_A162 Acetyltransferase; structural genomics, PSI, prote 99.28
1on0_A158 YYCN protein; structural genomics, alpha-beta prot 99.28
2b5g_A171 Diamine acetyltransferase 1; structural genomics, 99.27
2k5t_A128 Uncharacterized protein YHHK; N-acetyl transferase 99.27
2eui_A153 Probable acetyltransferase; dimer, structural geno 99.27
1z4e_A153 Transcriptional regulator; nysgxrc target T2017, G 99.27
3exn_A160 Probable acetyltransferase; GCN5-related N-acetylt 99.26
1z4r_A168 General control of amino acid synthesis protein 5- 99.25
1s3z_A165 Aminoglycoside 6'-N-acetyltransferase; GNAT, amino 99.25
2pdo_A144 Acetyltransferase YPEA; alpha-beta-alpha sandwich, 99.25
2i6c_A160 Putative acetyltransferase; GNAT family, structura 99.23
1wwz_A159 Hypothetical protein PH1933; structural genomics, 99.23
3ey5_A181 Acetyltransferase-like, GNAT family; structural ge 99.22
3i3g_A161 N-acetyltransferase; malaria, structural genomics, 99.22
2cnt_A160 Modification of 30S ribosomal subunit protein S18; 99.22
2oh1_A179 Acetyltransferase, GNAT family; YP_013287.1, struc 99.22
3ld2_A197 SMU.2055, putative acetyltransferase; HET: COA; 2. 99.21
1bo4_A168 Protein (serratia marcescens aminoglycoside-3-N- a 99.21
3dr6_A174 YNCA; acetyltransferase, csgid target, essential g 99.21
1ghe_A177 Acetyltransferase; acyl coenzyme A complex; HET: A 99.21
3lod_A162 Putative acyl-COA N-acyltransferase; structural ge 99.2
2cy2_A174 TTHA1209, probable acetyltransferase; structural g 99.18
3t90_A149 Glucose-6-phosphate acetyltransferase 1; GNAT fold 99.18
1y7r_A133 Hypothetical protein SA2161; structural genomics, 99.18
3owc_A188 Probable acetyltransferase; structural genomics, P 99.18
2ozh_A142 Hypothetical protein XCC2953; structural genomics, 99.18
2atr_A138 Acetyltransferase, GNAT family; MCSG, structural g 99.18
2q7b_A181 Acetyltransferase, GNAT family; NP_689019.1, struc 99.18
2jdc_A146 Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1. 99.16
2r7h_A177 Putative D-alanine N-acetyltransferase of GNAT FA; 99.15
1qst_A160 TGCN5 histone acetyl transferase; GCN5-related N-a 99.14
2fiw_A172 GCN5-related N-acetyltransferase:aminotransferase 99.14
2fl4_A149 Spermine/spermidine acetyltransferase; structural 99.14
2i79_A172 Acetyltransferase, GNAT family; acetyl coenzyme *A 99.14
1y9w_A140 Acetyltransferase; structural genomics, Pro struct 99.14
1yx0_A159 Hypothetical protein YSNE; NESG, GFT structral gen 99.14
2ae6_A166 Acetyltransferase, GNAT family; GCN5-related N-ace 99.13
2ge3_A170 Probable acetyltransferase; structural GEN PSI, pr 99.12
4ag7_A165 Glucosamine-6-phosphate N-acetyltransferase; HET: 99.12
2qec_A204 Histone acetyltransferase HPA2 and related acetylt 99.11
3ec4_A228 Putative acetyltransferase from the GNAT family; Y 99.1
1vhs_A175 Similar to phosphinothricin acetyltransferase; str 99.1
1n71_A180 AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, 99.09
2r1i_A172 GCN5-related N-acetyltransferase; YP_831484.1, put 99.09
2vez_A190 Putative glucosamine 6-phosphate acetyltransferase 99.09
3d3s_A189 L-2,4-diaminobutyric acid acetyltransferase; alpha 99.09
2g0b_A198 FEEM; N-acyl transferase, environmental DNA, prote 99.08
1m4i_A181 Aminoglycoside 2'-N-acetyltransferase; COA binding 99.07
3f5b_A182 Aminoglycoside N(6')acetyltransferase; APC60744, l 99.07
2gan_A190 182AA long hypothetical protein; alpha-beta protei 99.07
3f8k_A160 Protein acetyltransferase; GCN5-related N-acetyltr 99.07
2pc1_A201 Acetyltransferase, GNAT family; NP_688560.1, struc 99.06
3h4q_A188 Putative acetyltransferase; NP_371943.1, structura 99.05
2kcw_A147 Uncharacterized acetyltransferase YJAB; GNAT fold, 99.04
3igr_A184 Ribosomal-protein-S5-alanine N-acetyltransferase; 99.04
1i12_A160 Glucosamine-phosphate N-acetyltransferase; GNAT, a 99.04
2bue_A202 AAC(6')-IB; GNAT, transferase, aminoglycoside, flu 99.04
2jlm_A182 Putative phosphinothricin N-acetyltransferase; met 99.03
3d2m_A456 Putative acetylglutamate synthase; protein-COA-Glu 99.03
3ddd_A 288 Putative acetyltransferase; NP_142035.1, structura 99.03
4fd4_A217 Arylalkylamine N-acetyltransferase like 5B; GNAT; 99.02
2vi7_A177 Acetyltransferase PA1377; GNAT, GCN5 family, N-ace 99.01
1mk4_A157 Hypothetical protein YQJY; alpha-beta-alpha sandwi 99.01
1ygh_A164 ADA4, protein (transcriptional activator GCN5); tr 99.01
2g3a_A152 Acetyltransferase; structural genomics, PSI, prote 99.0
1yr0_A175 AGR_C_1654P, phosphinothricin acetyltransferase; s 99.0
2j8m_A172 Acetyltransferase PA4866 from P. aeruginosa; GCN5 99.0
2o28_A184 Glucosamine 6-phosphate N-acetyltransferase; struc 99.0
2q04_A211 Acetoin utilization protein; ZP_00540088.1, struct 98.98
1s7k_A182 Acetyl transferase; GNAT; 1.80A {Salmonella typhim 98.97
3s6f_A145 Hypothetical acetyltransferase; acyl-COA N-acyltra 98.96
3juw_A175 Probable GNAT-family acetyltransferase; structural 98.95
1r57_A102 Conserved hypothetical protein; GCN5, N-acetyltran 98.94
2fck_A181 Ribosomal-protein-serine acetyltransferase, putat; 98.94
3frm_A254 Uncharacterized conserved protein; APC61048, staph 98.94
3te4_A215 GH12636P, dopamine N acetyltransferase, isoform A; 98.94
3r9f_A188 MCCE protein; microcin C7, acetyltransferase, SELF 98.93
3eg7_A176 Spermidine N1-acetyltransferase; structural genomi 98.91
3pp9_A187 Putative streptothricin acetyltransferase; toxin p 98.91
1yre_A197 Hypothetical protein PA3270; APC5563, midwest cent 98.9
3g8w_A169 Lactococcal prophage PS3 protein 05; APC61042, ace 98.9
4fd5_A222 Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A 98.9
3tt2_A 330 GCN5-related N-acetyltransferase; structural genom 98.89
1y9k_A157 IAA acetyltransferase; structural genomics, midwes 98.88
3iwg_A276 Acetyltransferase, GNAT family; structural genomic 98.88
2fsr_A195 Acetyltransferase; alpha-beta-sandwich, structural 98.88
3eo4_A164 Uncharacterized protein MJ1062; APC60792.2,MJ_1062 98.87
3fbu_A168 Acetyltransferase, GNAT family; structur genomics, 98.86
4fd7_A238 Putative arylalkylamine N-acetyltransferase 7; GNA 98.86
1p0h_A 318 Hypothetical protein RV0819; GNAT fold, acetyltran 98.86
1nsl_A184 Probable acetyltransferase; structural genomics, h 98.85
2ozg_A 396 GCN5-related N-acetyltransferase; YP_325469.1, ace 98.84
3tth_A170 Spermidine N1-acetyltransferase; central intermedi 98.83
2pr1_A163 Uncharacterized N-acetyltransferase YLBP; YIBP pro 98.83
3r1k_A 428 Enhanced intracellular surviVal protein; GNAT, ace 98.83
3n7z_A 388 Acetyltransferase, GNAT family; PSI2, MCSG, struct 98.82
2d4p_A141 Hypothetical protein TTHA1254; structural genomics 98.82
1p0h_A318 Hypothetical protein RV0819; GNAT fold, acetyltran 98.81
2z10_A194 Ribosomal-protein-alanine acetyltransferase; alpha 98.81
2wpx_A 339 ORF14; transferase, acetyl transferase, antibiotic 98.81
3sxn_A 422 Enhanced intracellular surviVal protein; GNAT fold 98.81
3qb8_A197 A654L protein; GNAT N-acetyltransferase, acetyltra 98.79
2qml_A198 BH2621 protein; structural genomics, joint center 98.78
1yvk_A163 Hypothetical protein BSU33890; ALPHS-beta protein, 98.78
3pzj_A209 Probable acetyltransferases; MCSG, PSI-2, structur 98.74
3tt2_A330 GCN5-related N-acetyltransferase; structural genom 98.73
2wpx_A339 ORF14; transferase, acetyl transferase, antibiotic 98.72
3tcv_A246 GCN5-related N-acetyltransferase; GRAM negative co 98.72
2i00_A 406 Acetyltransferase, GNAT family; structural genomic 98.71
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 98.67
1yk3_A210 Hypothetical protein RV1347C/MT1389; acyltransfera 98.67
2hv2_A 400 Hypothetical protein; PSI, protein structure initi 98.64
3c26_A 266 Putative acetyltransferase TA0821; NP_394282.1, A 98.63
2vzy_A218 RV0802C; transferase, GCN5-related N-acetyltransfe 98.59
1xmt_A103 Putative acetyltransferase; structural genomics, p 98.46
1bob_A320 HAT1, histone acetyltransferase; histone modificat 98.42
3g3s_A249 GCN5-related N-acetyltransferase; ZP_00874857.1, a 98.39
2zw5_A 301 Bleomycin acetyltransferase; dimer, two domains; H 98.34
1sqh_A312 Hypothetical protein CG14615-PA; structural genomi 98.27
1ro5_A201 Autoinducer synthesis protein LASI; alpha-beta-alp 98.24
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 98.23
2ft0_A235 TDP-fucosamine acetyltransferase; GNAT fold acetyl 98.11
1yle_A 342 Arginine N-succinyltransferase, alpha chain; struc 98.04
3p2h_A201 AHL synthase; acyl-ACP binding, SAM binding, signa 98.01
4hkf_A191 Alpha-tubulin N-acetyltransferase; tubulin acetylt 97.28
4b5o_A200 Alpha-tubulin N-acetyltransferase; microtubules, c 97.13
4gs4_A240 Alpha-tubulin N-acetyltransferase; acetyl coenzyme 97.13
4h6u_A200 Alpha-tubulin N-acetyltransferase; tubulin acetylt 97.06
1kzf_A230 Acyl-homoserinelactone synthase ESAI; alpha-beta, 97.03
2p0w_A324 Histone acetyltransferase type B catalytic subuni; 96.96
3iu1_A 383 Glycylpeptide N-tetradecanoyltransferase 1; N-myri 96.75
2ou2_A 280 Histone acetyltransferase htatip; structural genom 96.59
2wuu_A 421 N-myristoyltransferase; acyltransferase; HET: NHM; 96.57
4b14_A 385 Glycylpeptide N-tetradecanoyltransferase; malaria, 96.53
3to7_A 276 Histone acetyltransferase ESA1; MYST family; HET: 96.36
1iyk_A 392 Myristoyl-COA:protein N-myristoyltransferase; HET: 96.36
2pq8_A 278 Probable histone acetyltransferase MYST1; MOF, str 96.33
1iic_A 422 Peptide N-myristoyltransferase; HET: MYA; 2.20A {S 96.32
2ozu_A 284 Histone acetyltransferase MYST3; structural genomi 96.3
1rxt_A 496 Myristoyl-, glycylpeptide N-tetradecanoyltransfera 95.77
3shp_A176 Putative acetyltransferase STHE_0691; PSI-biology, 95.59
3iwg_A 276 Acetyltransferase, GNAT family; structural genomic 95.55
3j21_g51 50S ribosomal protein L40E; archaea, archaeal, KIN 93.21
3s6g_A460 N-acetylglutamate kinase / N-acetylglutamate SYNT; 92.27
3dns_A135 Ribosomal-protein-alanine acetyltransferase; N-ter 91.21
3s6k_A467 Acetylglutamate kinase; synthase, transferase; 2.8 90.94
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 88.69
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 87.11
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 86.46
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 85.4
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 85.4
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 84.66
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 84.42
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 84.23
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 84.06
1ard_A29 Yeast transcription factor ADR1; transcription reg 83.55
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 83.49
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 83.43
1paa_A30 Yeast transcription factor ADR1; transcription reg 83.26
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 83.16
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 81.88
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 81.06
3gkr_A336 FEMX; FEMX, peptidoglycan, hexapeptide, transferas 80.53
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 80.47
>4a17_Y RPL37A, 60S ribosomal protein L32; eukaryotic ribosome, ribosome, eukaryotic initiation factor 60S, translation, large ribosomal subunit; 3.52A {Tetrahymena thermophila} PDB: 4a1a_Y 4a1c_Y 4a1e_Y Back     alignment and structure
>3j21_i 50S ribosomal protein L37AE; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3cc2_Z 50S ribosomal protein L37AE, 50S ribosomal protein L32E; genomic sequnece for R-proteins, ribonucleoprotein, ribosoma protein, RNA-binding; HET: 1MA OMU OMG UR3 PSU; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 3cc4_Z* 3cc7_Z* 3cce_Z* 3ccj_Z* 3ccl_Z* 3ccm_Z* 3ccq_Z* 3ccr_Z* 3ccs_Z* 3ccu_Z* 3ccv_Z* 3cd6_Z* 3cma_Z* 3cme_Z* 3i55_Z* 3i56_Z* 3cpw_Y* 4adx_Z Back     alignment and structure
>1ffk_W Ribosomal protein L37AE; ribosome assembly, RNA-RNA, protein-RNA, protein-protein; 2.40A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1jj2_Y 1k73_1* 1k8a_1* 1k9m_1* 1kc8_1* 1kd1_1* 1kqs_Y* 1m1k_1* 1m90_1* 1n8r_1* 1nji_1* 1q7y_1* 1q81_1* 1q82_1* 1q86_1* 1qvf_Y 1qvg_Y 1w2b_Y 3cxc_Y* Back     alignment and structure
>3jyw_9 60S ribosomal protein L43; eukaryotic ribosome, RACK1 protein, flexible fitting; 8.90A {Thermomyces lanuginosus} Back     alignment and structure
>1vq8_Z 50S ribosomal protein L37AE; ribosome 50S, protein-protein complex, RNA-RNA complex, PROT complex, peptidyl transferase reaction; HET: 1MA OMU OMG UR3 PSU SPS; 2.20A {Haloarcula marismortui} SCOP: g.41.8.1 PDB: 1vq4_Z* 1vq6_Z* 1vq5_Z* 1vq7_Z* 1vq9_Z* 1vqk_Z* 1vql_Z* 1vqm_Z* 1vqn_Z* 1vqo_Z* 1vqp_Z* 1yhq_Z* 1yi2_Z* 1yij_Z* 1yit_Z* 1yj9_Z* 1yjn_Z* 1yjw_Z* 2qa4_Z* 1s72_Z* ... Back     alignment and structure
>1tiq_A Protease synthase and sporulation negative regulatory protein PAI 1; alpha-beta protein, structural genomics, PSI; HET: COA; 1.90A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>4e0a_A BH1408 protein; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG, transferase; 1.80A {Bacillus halodurans} PDB: 4f6a_A* Back     alignment and structure
>1cjw_A Protein (serotonin N-acetyltransferase); HET: COT; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1b6b_A Back     alignment and structure
>3e0k_A Amino-acid acetyltransferase; N-acetylglutamate synthase, structu genomics, PSI-2, protein structure initiative; HET: MSE; 2.52A {Vibrio parahaemolyticus} Back     alignment and structure
>2bei_A Diamine acetyltransferase 2; SSAT2, BC011751, AAH11751, thialysine N-acetyltransferase, structural genomics, protein structure initiative, PSI; HET: ACO; 1.84A {Homo sapiens} SCOP: d.108.1.1 PDB: 2q4v_A* Back     alignment and structure
>2dxq_A AGR_C_4057P, acetyltransferase; structural genomics, PSI-2, protein struc initiative, midwest center for structural genomics, MCSG; 1.80A {Agrobacterium tumefaciens str} Back     alignment and structure
>2fe7_A Probable N-acetyltransferase; structural genomics, pseudomonas aerugi PSI, protein structure initiative; 2.00A {Pseudomonas aeruginosa ucbpp-pa14} SCOP: d.108.1.1 Back     alignment and structure
>3efa_A Putative acetyltransferase; structural genom 2, protein structure initiative, midwest center for structu genomics, MCSG; 2.42A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1kux_A Aralkylamine, serotonin N-acetyltransferase; enzyme-inhibitor complex, bisubstrate analog, alternate conformations; HET: CA3; 1.80A {Ovis aries} SCOP: d.108.1.1 PDB: 1kuv_A* 1kuy_A* 1l0c_A* 1ib1_E* Back     alignment and structure
>3t9y_A Acetyltransferase, GNAT family; PSI-biology, structural genomics, midwest center for structu genomics, MCSG; HET: PGE; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2ree_A CURA; GNAT, S-acetyltransferase, decarboxylase, polyketid synthase, loading, phosphopantetheine, transferase, lyase; HET: SO4; 1.95A {Lyngbya majuscula} PDB: 2ref_A* Back     alignment and structure
>1vkc_A Putative acetyl transferase; structural genomics, pyrococcus furiosus southeast collaboratory for structural genomics, secsg; 1.89A {Pyrococcus furiosus} SCOP: d.108.1.1 Back     alignment and structure
>3fyn_A Integron gene cassette protein HFX_CASS3; integron cassette protein, mobIle metagenome, structural genomics, PSI-2; 1.45A {Uncultured bacterium} Back     alignment and structure
>3gy9_A GCN5-related N-acetyltransferase; YP_001815201.1, putative acetyltransferase; HET: MSE COA SO4; 1.52A {Exiguobacterium sibiricum 255-15} PDB: 3gya_A* Back     alignment and structure
>2ob0_A Human MAK3 homolog; acetyltransferase, structural genomics consortium, SGC; HET: ACO; 1.80A {Homo sapiens} PDB: 2psw_A* 3tfy_A* Back     alignment and structure
>2q0y_A GCN5-related N-acetyltransferase; YP_295895.1, acetyltransferase (GNAT) family, structural genomics, joint center for ST genomics; HET: MSE; 1.80A {Ralstonia eutropha JMP134} Back     alignment and structure
>2x7b_A N-acetyltransferase SSO0209; HET: COA; 1.95A {Sulfolobus solfataricus} Back     alignment and structure
>3fnc_A Protein LIN0611, putative acetyltransferase; GNAT, RIMI, structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.75A {Listeria innocua} SCOP: d.108.1.0 Back     alignment and structure
>1xeb_A Hypothetical protein PA0115; midwest center for structural genomics, MCSG, structural GEN protein structure initiative, PSI, APC22065; 2.35A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>4h89_A GCN5-related N-acetyltransferase; N-acyltransferase superfamily, structural genomics, PSI-BIOL midwest center for structural genomics, MCSG; 1.37A {Kribbella flavida} Back     alignment and structure
>3jvn_A Acetyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 2.61A {Vibrio fischeri} Back     alignment and structure
>3mgd_A Predicted acetyltransferase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; HET: ACO; 1.90A {Clostridium acetobutylicum} Back     alignment and structure
>1qsm_A HPA2 histone acetyltransferase; protein-acetyl coenzyme A complex; HET: ACO; 2.40A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1qso_A Back     alignment and structure
>3dsb_A Putative acetyltransferase; APC60368.2, ST genomics, PSI-2, protein structure initiative, midwest CENT structural genomics, MCSG; HET: MSE; 1.48A {Clostridium difficile} Back     alignment and structure
>3i9s_A Integron cassette protein; oyster POND, woods HOLE, acetyltransferase, structural genomics, PSI-2, protein structure initiative; 2.20A {Vibrio cholerae} Back     alignment and structure
>3fix_A N-acetyltransferase; termoplasma acidophilum, structural GEN PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 2.30A {Thermoplasma acidophilum} PDB: 3f0a_A* 3k9u_A* 3ne7_A* Back     alignment and structure
>1q2y_A Protein YJCF, similar to hypothetical proteins; GCN5-related N-acetyltransferase superfamily fold, NYSGXRC, PSI, protein structure initiative; 2.00A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>4evy_A Aminoglycoside N(6')-acetyltransferase type 1; center for structural genomics of infectious diseases (csgid national institute of allergy and infectious diseases; HET: TOY; 1.77A {Acinetobacter haemolyticus} PDB: 4f0y_A 4e8o_A Back     alignment and structure
>3d8p_A Acetyltransferase of GNAT family; NP_373092.1, structural GE joint center for structural genomics, JCSG, protein structu initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1u6m_A Acetyltransferase, GNAT family; structural genomics, PSI, protein structure initiative; 2.40A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1ufh_A YYCN protein; alpha and beta, fold, acetyltransferase, structural genomics, PSI, protein structure initiative; 2.20A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3kkw_A Putative uncharacterized protein; acetyltransferase, GNAT family, structural genomics, PSI, protein structure initiative; 1.41A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>3bln_A Acetyltransferase GNAT family; NP_981174.1, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE MRD GOL; 1.31A {Bacillus cereus} Back     alignment and structure
>2aj6_A Hypothetical protein MW0638; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.63A {Staphylococcus aureus subsp} SCOP: d.108.1.1 Back     alignment and structure
>2fia_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 2.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>1on0_A YYCN protein; structural genomics, alpha-beta protein with anti-parallel B strands, PSI, protein structure initiative; 2.20A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2b5g_A Diamine acetyltransferase 1; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: ALY; 1.70A {Homo sapiens} SCOP: d.108.1.1 PDB: 2b4d_A* 2jev_A* 2g3t_A 2f5i_A 2b3u_A 2b3v_A* 2b4b_A* 2b58_A* 2fxf_A* 3bj7_A* 3bj8_A* Back     alignment and structure
>2k5t_A Uncharacterized protein YHHK; N-acetyl transferase, COA, bound ligand, coenzyme A, structural genomics, PSI-2, protein structure initiative; HET: COA; NMR {Escherichia coli K12} Back     alignment and structure
>2eui_A Probable acetyltransferase; dimer, structural genomics, PSI, protein structure initiative; 2.80A {Pseudomonas aeruginosa PAO1} SCOP: d.108.1.1 Back     alignment and structure
>1z4e_A Transcriptional regulator; nysgxrc target T2017, GNAT fold, structural genomics, PSI, P structure initiative; 2.00A {Bacillus halodurans} SCOP: d.108.1.1 Back     alignment and structure
>3exn_A Probable acetyltransferase; GCN5-related N-acetyltransferase, MCSG, P structural genomics, protein structure initiative; HET: ACO; 1.80A {Thermus thermophilus} Back     alignment and structure
>1z4r_A General control of amino acid synthesis protein 5-like 2; GCN5, acetyltransferase, SGC, structural genomics, structural genomics consortium; HET: ACO; 1.74A {Homo sapiens} SCOP: d.108.1.1 PDB: 1cm0_B* Back     alignment and structure
>1s3z_A Aminoglycoside 6'-N-acetyltransferase; GNAT, aminoglycoside ribostamycin; HET: COA RIO; 2.00A {Salmonella enteritidis} SCOP: d.108.1.1 PDB: 1s5k_A* 1s60_A* 2vbq_A* Back     alignment and structure
>2pdo_A Acetyltransferase YPEA; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 2.00A {Shigella flexneri 2A} Back     alignment and structure
>2i6c_A Putative acetyltransferase; GNAT family, structural genomic, structur genomics, PSI-2, protein structure initiative; HET: MSE EPE; 1.30A {Pseudomonas aeruginosa} SCOP: d.108.1.1 PDB: 3pgp_A* Back     alignment and structure
>1wwz_A Hypothetical protein PH1933; structural genomics, pyrococcus horikoshii OT3, riken struct genomics/proteomics initiative, RSGI; HET: ACO; 1.75A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3ey5_A Acetyltransferase-like, GNAT family; structural genomics, APC60148, GNAT famil protein structure initiative; 2.15A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3i3g_A N-acetyltransferase; malaria, structural genomics, structural genomics consortium, SGC,; 1.86A {Trypanosoma brucei} PDB: 3fb3_A Back     alignment and structure
>2cnt_A Modification of 30S ribosomal subunit protein S18; N-alpha acetylation, GCN5-N-acetyltransferase, ribosomal Pro acetyltransferase, GNAT; HET: COA; 2.4A {Salmonella typhimurium} PDB: 2cnm_A* 2cns_A* Back     alignment and structure
>2oh1_A Acetyltransferase, GNAT family; YP_013287.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE UNL; 1.46A {Listeria monocytogenes str} Back     alignment and structure
>3ld2_A SMU.2055, putative acetyltransferase; HET: COA; 2.50A {Streptococcus mutans} Back     alignment and structure
>1bo4_A Protein (serratia marcescens aminoglycoside-3-N- acetyltransferase); eubacterial aminoglyco resistance, GCN5-related N-acetyltransferase; HET: SPD COA; 2.30A {Serratia marcescens} SCOP: d.108.1.1 Back     alignment and structure
>3dr6_A YNCA; acetyltransferase, csgid target, essential gene, IDP00086, structural genomics, center for STRU genomics of infectious diseases; HET: MSE; 1.75A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 3dr8_A* Back     alignment and structure
>1ghe_A Acetyltransferase; acyl coenzyme A complex; HET: ACO; 1.55A {Pseudomonas syringae PV} SCOP: d.108.1.1 PDB: 1j4j_A* Back     alignment and structure
>3lod_A Putative acyl-COA N-acyltransferase; structural genomics, PSI2, MCSG, structure initiative; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2cy2_A TTHA1209, probable acetyltransferase; structural genomics, unknown function, NPPSFA; HET: ACO; 2.00A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 1wk4_A* Back     alignment and structure
>3t90_A Glucose-6-phosphate acetyltransferase 1; GNAT fold, glcnac biosynthesis, alpha/beta protein; HET: EPE; 1.50A {Arabidopsis thaliana} Back     alignment and structure
>1y7r_A Hypothetical protein SA2161; structural genomics, protein structure initiative, PSI, midwest center for structural genomics; 1.70A {Staphylococcus aureus} SCOP: d.108.1.1 Back     alignment and structure
>3owc_A Probable acetyltransferase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: COA; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>2ozh_A Hypothetical protein XCC2953; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.40A {Xanthomonas campestris PV} Back     alignment and structure
>2atr_A Acetyltransferase, GNAT family; MCSG, structural genomics, PSI, protein structure INIT midwest center for structural genomics; 2.01A {Streptococcus pneumoniae} SCOP: d.108.1.1 Back     alignment and structure
>2q7b_A Acetyltransferase, GNAT family; NP_689019.1, structural GEN joint center for structural genomics, JCSG; HET: MSE FLC; 2.00A {Streptococcus agalactiae 2603V} Back     alignment and structure
>2jdc_A Glyphosate N-acetyltransferase; GNAT; HET: CAO; 1.6A {Bacillus licheniformis} SCOP: d.108.1.1 PDB: 2bsw_A* 2jdd_A* Back     alignment and structure
>2r7h_A Putative D-alanine N-acetyltransferase of GNAT FA; putative acetyltransferase of the GNAT family; 1.85A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>1qst_A TGCN5 histone acetyl transferase; GCN5-related N-acetyltransferase, COA binding protein; HET: EPE; 1.70A {Tetrahymena thermophila} SCOP: d.108.1.1 PDB: 1m1d_A* 1pu9_A* 1pua_A* 5gcn_A* 1qsr_A* 1q2d_A* 1q2c_A* 1qsn_A* Back     alignment and structure
>2fiw_A GCN5-related N-acetyltransferase:aminotransferase II; alpha-beta-alpha sandwich, GCN4-related acetyltransferase, S genomics, PSI; HET: ACO; 2.35A {Rhodopseudomonas palustris} SCOP: d.108.1.1 Back     alignment and structure
>2fl4_A Spermine/spermidine acetyltransferase; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG; 1.60A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2i79_A Acetyltransferase, GNAT family; acetyl coenzyme *A, structur genomics, PSI-2, protein structure initiative; HET: ACO; 2.10A {Streptococcus pneumoniae} Back     alignment and structure
>1y9w_A Acetyltransferase; structural genomics, Pro structure initiative, PSI, midwest center for structural GE MCSG; 1.90A {Bacillus cereus} SCOP: d.108.1.1 Back     alignment and structure
>1yx0_A Hypothetical protein YSNE; NESG, GFT structral genomics, SR220, structural genomics, PSI, protein structure initiative; NMR {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>2ae6_A Acetyltransferase, GNAT family; GCN5-related N-acetyltransferase (GNAT), alpha-beta, structu genomics, PSI, protein structure initiative; HET: GOL; 2.19A {Enterococcus faecalis} SCOP: d.108.1.1 Back     alignment and structure
>2ge3_A Probable acetyltransferase; structural GEN PSI, protein structure initiative, midwest center for struc genomics, MCSG; HET: ACO; 2.25A {Agrobacterium tumefaciens} SCOP: d.108.1.1 Back     alignment and structure
>4ag7_A Glucosamine-6-phosphate N-acetyltransferase; HET: COA; 1.55A {Caenorhabditis elegans} PDB: 4ag9_A* Back     alignment and structure
>2qec_A Histone acetyltransferase HPA2 and related acetyltransferases; NP_600742.1, acetyltransferase (GNAT) family; 1.90A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ec4_A Putative acetyltransferase from the GNAT family; YP_497011.1, joint center for structural genomics; 1.80A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>1vhs_A Similar to phosphinothricin acetyltransferase; structural genomics, unknown function; 1.80A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1n71_A AAC(6')-II; aminoglycoside 6'-N-acetyltransferase, antibiotic resistance, coenzyme A; HET: COA; 1.80A {Enterococcus faecium} SCOP: d.108.1.1 PDB: 2a4n_A* 1b87_A* Back     alignment and structure
>2r1i_A GCN5-related N-acetyltransferase; YP_831484.1, putative acetyltransferase, arthrobacter SP. FB acetyltransferase (GNAT) family; HET: MSE; 1.65A {Arthrobacter SP} Back     alignment and structure
>2vez_A Putative glucosamine 6-phosphate acetyltransferase; acyltransferase; HET: ACO G6P; 1.45A {Aspergillus fumigatus} PDB: 2vxk_A* Back     alignment and structure
>3d3s_A L-2,4-diaminobutyric acid acetyltransferase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; HET: MSE; 1.87A {Bordetella parapertussis 12822} Back     alignment and structure
>2g0b_A FEEM; N-acyl transferase, environmental DNA, protein-product compl antibiotic synthase, transferase; HET: NLT; 3.00A {Uncultured bacterium} Back     alignment and structure
>1m4i_A Aminoglycoside 2'-N-acetyltransferase; COA binding motif; HET: COA KAN PAP; 1.50A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1m4d_A* 1m4g_A* 1m44_A* Back     alignment and structure
>3f5b_A Aminoglycoside N(6')acetyltransferase; APC60744, legionella pneumophila subsp. pneumophila, structural genomics, PSI-2; HET: MSE; 2.00A {Legionella pneumophila subsp} Back     alignment and structure
>2gan_A 182AA long hypothetical protein; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.10A {Pyrococcus horikoshii} SCOP: d.108.1.1 Back     alignment and structure
>3f8k_A Protein acetyltransferase; GCN5-related N-acetyltransferase; HET: COA; 1.84A {Sulfolobus solfataricus P2} Back     alignment and structure
>2pc1_A Acetyltransferase, GNAT family; NP_688560.1, structural genom joint center for structural genomics, JCSG; HET: MSE; 1.28A {Streptococcus agalactiae 2603V} Back     alignment and structure
>3h4q_A Putative acetyltransferase; NP_371943.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE P33; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>2kcw_A Uncharacterized acetyltransferase YJAB; GNAT fold, acyltransferase; NMR {Escherichia coli} Back     alignment and structure
>3igr_A Ribosomal-protein-S5-alanine N-acetyltransferase; fisch MCSG, structural genomics, midwest center for structural GE protein structure initiative; HET: MSE; 2.00A {Vibrio fischeri} SCOP: d.108.1.0 Back     alignment and structure
>1i12_A Glucosamine-phosphate N-acetyltransferase; GNAT, alpha/beta; HET: ACO; 1.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 1i1d_A* 1i21_A Back     alignment and structure
>2bue_A AAC(6')-IB; GNAT, transferase, aminoglycoside, fluoroquinolone, acetyltransferase, antibiotic resistance; HET: COA RIO; 1.7A {Escherichia coli} PDB: 1v0c_A* 2vqy_A* 2prb_A* 2qir_A* 2pr8_A* Back     alignment and structure
>2jlm_A Putative phosphinothricin N-acetyltransferase; methionine sulfoximine; 2.35A {Acinetobacter baylyi} Back     alignment and structure
>3d2m_A Putative acetylglutamate synthase; protein-COA-Glu ternary complex, transferase; HET: COA GLU; 2.21A {Neisseria gonorrhoeae} PDB: 2r8v_A* 3b8g_A* 2r98_A* 3d2p_A* Back     alignment and structure
>3ddd_A Putative acetyltransferase; NP_142035.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: COA; 2.25A {Pyrococcus horikoshii} Back     alignment and structure
>4fd4_A Arylalkylamine N-acetyltransferase like 5B; GNAT; 1.95A {Aedes aegypti} Back     alignment and structure
>2vi7_A Acetyltransferase PA1377; GNAT, GCN5 family, N-acetyltransferase, hypothetical protein; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1mk4_A Hypothetical protein YQJY; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>1ygh_A ADA4, protein (transcriptional activator GCN5); transcriptional regulation, histone acetylation; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>2g3a_A Acetyltransferase; structural genomics, PSI, protein structu initiative, midwest center for structural genomics, MCSG; 1.90A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>1yr0_A AGR_C_1654P, phosphinothricin acetyltransferase; structural genomics, protein structure initiative, NYSGXRC, PSI; 2.00A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>2j8m_A Acetyltransferase PA4866 from P. aeruginosa; GCN5 family, phosphinothricin, methionine sulfone, methionine sulfoximine; 1.44A {Pseudomonas aeruginosa} PDB: 2bl1_A 2j8n_A 2j8r_A* 1yvo_A Back     alignment and structure
>2o28_A Glucosamine 6-phosphate N-acetyltransferase; structural genomics, structural genomics consortium, SGC; HET: 16G COA; 1.80A {Homo sapiens} PDB: 2huz_A* 3cxq_A* 3cxs_A 3cxp_A Back     alignment and structure
>2q04_A Acetoin utilization protein; ZP_00540088.1, structural genom joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.33A {Exiguobacterium sibiricum} Back     alignment and structure
>1s7k_A Acetyl transferase; GNAT; 1.80A {Salmonella typhimurium} SCOP: d.108.1.1 PDB: 1s7l_A* 1s7n_A* 1s7f_A 1z9u_A Back     alignment and structure
>3s6f_A Hypothetical acetyltransferase; acyl-COA N-acyltransferases, structural genomics, joint CENT structural genomics, JCSG; HET: MSE COA; 1.19A {Deinococcus radiodurans} Back     alignment and structure
>3juw_A Probable GNAT-family acetyltransferase; structural genomics, APC60242, acetyltransferas protein structure initiative; HET: MSE; 2.11A {Bordetella pertussis} Back     alignment and structure
>1r57_A Conserved hypothetical protein; GCN5, N-acetyltransferase, structural genomics, PSI, protein structure initiative; NMR {Staphylococcus aureus} SCOP: d.108.1.1 PDB: 2h5m_A* Back     alignment and structure
>2fck_A Ribosomal-protein-serine acetyltransferase, putat; ribosomal-protein structural genomics, PSI, protein structure initiative; HET: MSE; 1.70A {Vibrio cholerae o1 biovar eltor} SCOP: d.108.1.1 Back     alignment and structure
>3frm_A Uncharacterized conserved protein; APC61048, staphylococcus epidermidis ATCC structural genomics, PSI-2, protein structure initiative; HET: MES; 2.32A {Staphylococcus epidermidis} Back     alignment and structure
>3te4_A GH12636P, dopamine N acetyltransferase, isoform A; dopamine/acetyl COA, N-acetyltransferase domain; HET: ACO; 1.46A {Drosophila melanogaster} PDB: 3v8i_A* Back     alignment and structure
>3r9f_A MCCE protein; microcin C7, acetyltransferase, SELF immunity, resistance, A coenzyme A, transferase; HET: COA GSU; 1.20A {Escherichia coli} PDB: 3r95_A* 3r96_A* 3r9e_A* 3r9g_A* Back     alignment and structure
>3eg7_A Spermidine N1-acetyltransferase; structural genomics, IDP016 transferase, center for structural genomics of infectious D csgid; HET: MSE; 2.38A {Vibrio cholerae} SCOP: d.108.1.0 Back     alignment and structure
>3pp9_A Putative streptothricin acetyltransferase; toxin production resistance, infectious diseases, structural genomics; HET: MSE ACO; 1.60A {Bacillus anthracis} Back     alignment and structure
>1yre_A Hypothetical protein PA3270; APC5563, midwest center for structural genomics, MSC protein structure initiative, PSI, MCSG; HET: COA; 2.15A {Pseudomonas aeruginosa} SCOP: d.108.1.1 Back     alignment and structure
>3g8w_A Lactococcal prophage PS3 protein 05; APC61042, acetyltransferase, staphylococcus epidermidis ATCC structural genomics; HET: NHE FLC; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>4fd5_A Arylalkylamine N-acetyltransferase 2; GNAT; 1.64A {Aedes aegypti} PDB: 4fd6_A Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>1y9k_A IAA acetyltransferase; structural genomics, midwest center for structural genomics bacillus cereus ATCC 14579, PSI; 2.39A {Bacillus cereus atcc 14579} SCOP: d.108.1.1 Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>2fsr_A Acetyltransferase; alpha-beta-sandwich, structural genomics, PSI, protein struc initiative, midwest center for structural genomics; HET: PEG; 1.52A {Agrobacterium tumefaciens str} SCOP: d.108.1.1 Back     alignment and structure
>3eo4_A Uncharacterized protein MJ1062; APC60792.2,MJ_1062,methanocaldococcus jannaschii DSM 2661, S genomics, PSI-2; HET: MES PG6; 2.19A {Methanocaldococcus jannaschii} Back     alignment and structure
>3fbu_A Acetyltransferase, GNAT family; structur genomics, PSI2, MCSG, protein structure initiative, midwest for structural genomics; HET: COA; 1.80A {Bacillus anthracis str} Back     alignment and structure
>4fd7_A Putative arylalkylamine N-acetyltransferase 7; GNAT, COA binding; 1.80A {Aedes aegypti} Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>1nsl_A Probable acetyltransferase; structural genomics, hexamer, alpha-beta, PSI, protein struc initiative, midwest center for structural genomics; 2.70A {Bacillus subtilis} SCOP: d.108.1.1 Back     alignment and structure
>2ozg_A GCN5-related N-acetyltransferase; YP_325469.1, acetyltransfe (GNAT) family, structural genomics, joint center for struct genomics, JCSG; HET: COA; 2.00A {Anabaena variabilis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3tth_A Spermidine N1-acetyltransferase; central intermediary metabolism; 3.30A {Coxiella burnetii} Back     alignment and structure
>2pr1_A Uncharacterized N-acetyltransferase YLBP; YIBP protein, coenzyme A, structural GE PSI-2, protein structure initiative; HET: SUC COA; 3.20A {Bacillus subtilis} Back     alignment and structure
>3r1k_A Enhanced intracellular surviVal protein; GNAT, acetyltransferase, transferase; HET: COA; 1.95A {Mycobacterium tuberculosis} PDB: 3sxo_A 3ryo_A 3uy5_A Back     alignment and structure
>3n7z_A Acetyltransferase, GNAT family; PSI2, MCSG, structural genomics, protein structure initiativ midwest center for structural genomics; 2.75A {Bacillus anthracis} Back     alignment and structure
>2d4p_A Hypothetical protein TTHA1254; structural genomics, NPPSFA, national project on protein STR and functional analyses; 1.70A {Thermus thermophilus} SCOP: d.108.1.1 PDB: 2d4o_A Back     alignment and structure
>1p0h_A Hypothetical protein RV0819; GNAT fold, acetyltransferase, coenzyme A complex, MSHD, TRAN; HET: COA ACO; 1.60A {Mycobacterium tuberculosis} SCOP: d.108.1.1 PDB: 1ozp_A* 2c27_A* Back     alignment and structure
>2z10_A Ribosomal-protein-alanine acetyltransferase; alpha/beta protein, acyltransferase, structural genomics, NPPSFA; HET: IYR; 1.77A {Thermus thermophilus} PDB: 2z0z_A* 2z11_A* 2zxv_A* Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3sxn_A Enhanced intracellular surviVal protein; GNAT fold, acetyltransferase, acetyl COA binding, transferas; HET: COA; 2.03A {Mycobacterium smegmatis} Back     alignment and structure
>3qb8_A A654L protein; GNAT N-acetyltransferase, acetyltransferase, COA, spermine, spermidine, transferase; HET: COA; 1.50A {Paramecium bursaria chlorella virus 1} Back     alignment and structure
>2qml_A BH2621 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, unknown function; HET: MSE; 1.55A {Bacillus halodurans} Back     alignment and structure
>1yvk_A Hypothetical protein BSU33890; ALPHS-beta protein, structural genomics, PSI, protein structure initiative; HET: COA; 3.01A {Bacillus subtilis subsp} SCOP: d.108.1.1 Back     alignment and structure
>3pzj_A Probable acetyltransferases; MCSG, PSI-2, structural genomics, protein structure initiati midwest center for structural genomics; HET: MSE; 1.85A {Chromobacterium violaceum} Back     alignment and structure
>3tt2_A GCN5-related N-acetyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta sandwich; HET: MES; 2.73A {Sphaerobacter thermophilus} Back     alignment and structure
>2wpx_A ORF14; transferase, acetyl transferase, antibiotic biosynthesis; HET: ACO; 2.31A {Streptomyces clavuligerus} PDB: 2wpw_A* Back     alignment and structure
>3tcv_A GCN5-related N-acetyltransferase; GRAM negative coccobacillus, brucellosis, acyl CO-A, arylami transferase; 1.75A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} Back     alignment and structure
>2i00_A Acetyltransferase, GNAT family; structural genomics, PSI-2, structure initiative, midwest center for structural genomic transferase; 2.30A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>1yk3_A Hypothetical protein RV1347C/MT1389; acyltransferase, GCN5-related fold, structural genomics, PSI, protein structure initiative; HET: BOG; 2.20A {Mycobacterium tuberculosis} SCOP: d.108.1.1 Back     alignment and structure
>2hv2_A Hypothetical protein; PSI, protein structure initiative, midwest center for struct genomics, MCSG, structural genomics, unknown function; HET: EPE PG4; 2.40A {Enterococcus faecalis} SCOP: d.106.1.4 d.108.1.10 Back     alignment and structure
>3c26_A Putative acetyltransferase TA0821; NP_394282.1, A putative acetyltransferase, acetyltransferase family, structural genomics; 2.00A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2vzy_A RV0802C; transferase, GCN5-related N-acetyltransferase, succinyltransferase; HET: FLC; 2.00A {Mycobacterium tuberculosis} PDB: 2vzz_A* Back     alignment and structure
>1xmt_A Putative acetyltransferase; structural genomics, protein structure initiative, CESG, AT1G77540, center for eukaryotic structural genomics; 1.15A {Arabidopsis thaliana} SCOP: d.108.1.1 PDB: 2q44_A 2evn_A 2il4_A* 2q4y_A* Back     alignment and structure
>1bob_A HAT1, histone acetyltransferase; histone modification, acetyl coenzyme A binding-protein; HET: ACO; 2.30A {Saccharomyces cerevisiae} SCOP: d.108.1.1 Back     alignment and structure
>3g3s_A GCN5-related N-acetyltransferase; ZP_00874857.1, acetyltransferase (GNAT) family, structural joint center for structural genomics, JCSG; HET: MSE; 1.80A {Streptococcus suis} Back     alignment and structure
>2zw5_A Bleomycin acetyltransferase; dimer, two domains; HET: COA; 2.40A {Streptomyces verticillus} PDB: 2zw4_A* 2zw6_A 2zw7_A* Back     alignment and structure
>1sqh_A Hypothetical protein CG14615-PA; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Drosophila melanogaster} SCOP: d.108.1.5 Back     alignment and structure
>1ro5_A Autoinducer synthesis protein LASI; alpha-beta-alpha sandwich, phosphopantetheine fold, signalin; 2.30A {Pseudomonas aeruginosa} SCOP: d.108.1.3 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2ft0_A TDP-fucosamine acetyltransferase; GNAT fold acetyltransferase, structural genomics, montreal-K bacterial structural genomics initiative, BSGI; HET: ACO; 1.66A {Escherichia coli} PDB: 2fs5_A* Back     alignment and structure
>1yle_A Arginine N-succinyltransferase, alpha chain; structural genomics, acyltransferase, arginine metabolism, protein structure initiative; 1.70A {Pseudomonas aeruginosa} SCOP: d.108.1.8 Back     alignment and structure
>3p2h_A AHL synthase; acyl-ACP binding, SAM binding, signaling protein-I MTA complex, signaling protein-inhibitor complex; HET: MTA NOO; 2.00A {Burkholderia glumae} PDB: 3p2f_A* Back     alignment and structure
>4hkf_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase, MEC-17, GNAT, acetyl-COA, GNAT FO transferase; HET: ACO; 1.70A {Danio rerio} PDB: 4h6u_A* 4h6z_A* Back     alignment and structure
>4b5o_A Alpha-tubulin N-acetyltransferase; microtubules, cilium, intraflagellar transport; HET: ACO; 1.05A {Homo sapiens} PDB: 4b5p_A* Back     alignment and structure
>4gs4_A Alpha-tubulin N-acetyltransferase; acetyl coenzyme A binding, cytosolic; HET: ACO; 2.11A {Homo sapiens} Back     alignment and structure
>4h6u_A Alpha-tubulin N-acetyltransferase; tubulin acetyltransferase; HET: ACO; 2.45A {Danio rerio} PDB: 4h6z_A* Back     alignment and structure
>1kzf_A Acyl-homoserinelactone synthase ESAI; alpha-beta, autoinducer synthase, quorum sensing, bacterial pathogenesis, ligase; 1.80A {Pantoea stewartii subsp} SCOP: d.108.1.3 PDB: 1k4j_A Back     alignment and structure
>2p0w_A Histone acetyltransferase type B catalytic subuni; HAT1, structural genomics, structural genomics consortium, S transferase; HET: ACO; 1.90A {Homo sapiens} Back     alignment and structure
>3iu1_A Glycylpeptide N-tetradecanoyltransferase 1; N-myristoyltransferase, NMT1, acyltransferase, phosphoprotein, structural genomics; HET: MYA; 1.42A {Homo sapiens} PDB: 3iu2_A* 3iwe_A* 3jtk_A* Back     alignment and structure
>2ou2_A Histone acetyltransferase htatip; structural genomics, structural genomics consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} Back     alignment and structure
>2wuu_A N-myristoyltransferase; acyltransferase; HET: NHM; 1.42A {Leishmania donovani} PDB: 3h5z_A* 4a2z_A* 4a30_A* 4a31_A* 4a32_A* 4a33_A* 2wsa_A* Back     alignment and structure
>4b14_A Glycylpeptide N-tetradecanoyltransferase; malaria, drug design; HET: NHW 4XB; 1.50A {Plasmodium vivax} PDB: 4b11_A* 4b12_A* 4b13_A* 4b10_A* 4a95_A* Back     alignment and structure
>3to7_A Histone acetyltransferase ESA1; MYST family; HET: ALY COA; 1.90A {Saccharomyces cerevisiae} SCOP: d.108.1.1 PDB: 3to6_A* 1fy7_A* 1mja_A* 1mjb_A* 3to9_A* 1mj9_A* Back     alignment and structure
>1iyk_A Myristoyl-COA:protein N-myristoyltransferase; HET: MYA MIM; 2.30A {Candida albicans} SCOP: d.108.1.2 d.108.1.2 PDB: 1iyl_A* 1nmt_A Back     alignment and structure
>2pq8_A Probable histone acetyltransferase MYST1; MOF, structural genomics, structural genomics consortium, SGC; HET: COA; 1.45A {Homo sapiens} PDB: 2giv_A* 3qah_A* 2y0m_A* 3toa_A* 3tob_A* Back     alignment and structure
>1iic_A Peptide N-myristoyltransferase; HET: MYA; 2.20A {Saccharomyces cerevisiae} SCOP: d.108.1.2 d.108.1.2 PDB: 1iid_A* 2nmt_A* 2p6e_A* 2p6f_A* 2p6g_A* Back     alignment and structure
>2ozu_A Histone acetyltransferase MYST3; structural genomics, structural G consortium, SGC; HET: ALY ACO; 2.30A {Homo sapiens} SCOP: d.108.1.1 PDB: 2rc4_A* 1m36_A Back     alignment and structure
>1rxt_A Myristoyl-, glycylpeptide N-tetradecanoyltransferase 1; alpha-beta structure, unique N-myristoyltransferase fold; 3.00A {Homo sapiens} SCOP: d.108.1.2 d.108.1.2 Back     alignment and structure
>3shp_A Putative acetyltransferase STHE_0691; PSI-biology, midwest center for structural genomics, MCSG; HET: SRT; 2.21A {Sphaerobacter thermophilus} Back     alignment and structure
>3iwg_A Acetyltransferase, GNAT family; structural genomics, APC, PSI-2, protein structure initiativ midwest center for structural genomics; HET: MSE; 2.30A {Colwellia psychrerythraea} Back     alignment and structure
>3j21_g 50S ribosomal protein L40E; archaea, archaeal, KINK-turn, protein synthe ribosome; 6.60A {Pyrococcus furiosus} Back     alignment and structure
>3s6g_A N-acetylglutamate kinase / N-acetylglutamate SYNT; synthase, transferase; HET: COA; 2.67A {Maricaulis maris} PDB: 3s7y_A 3s6h_A* Back     alignment and structure
>3dns_A Ribosomal-protein-alanine acetyltransferase; N-terminal domain of ribosomal-protein-alanine acetyltransfe MCSG, PSI; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3s6k_A Acetylglutamate kinase; synthase, transferase; 2.80A {Xanthomonas campestris PV} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3gkr_A FEMX; FEMX, peptidoglycan, hexapeptide, transferase, transferase- transferase product complex; HET: UMA; 1.60A {Lactobacillus viridescens} PDB: 1ne9_A 1p4n_A* 1xix_A 1xf8_A 1xe4_A Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 152
d1vqoz173 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archae 5e-18
d1jj2y_73 g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Ha 1e-17
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

 Score = 71.2 bits (175), Expect = 5e-18
 Identities = 11/35 (31%), Positives = 21/35 (60%)

Query: 11 TGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKE 45
          +G++G RYG   R+ V ++E   +  + C  CG++
Sbjct: 2  SGRFGARYGRVSRRRVAEIESEMNEDHACPNCGED 36
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query152
d1jj2y_73 Ribosomal protein L37ae {Archaeon Haloarcula maris 99.74
d1vqoz173 Ribosomal protein L37ae {Archaeon Haloarcula maris 99.74
d1tiqa_173 Protease synthase and sporulation negative regulat 99.52
d2aj6a1118 Hypothetical protein MW0638 {Staphylococcus aureus 99.47
d2fe7a1156 Probable N-acetyltransferase PA0478 {Pseudomonas a 99.47
d1bo4a_137 Aminoglycoside 3-N-acetyltransferase {Serratia mar 99.42
d1vkca_149 Putative acetyltransferase PF0028 {Pyrococcus furi 99.37
d1s3za_147 Aminoglycoside N-acetyltransferase AAC(6')-IY {Sal 99.37
d1ufha_155 Putative acetyltransferase YycN {Bacillus subtilis 99.35
d1qsra_162 Catalytic domain of GCN5 histone acetyltransferase 99.35
d2atra1137 Probable acetyltransferase SP0256 {Streptococcus p 99.34
d2fiaa1157 Probable acetyltransferase EF1919 {Enterococcus fa 99.33
d1cjwa_166 Serotonin N-acetyltranferase {Sheep (Ovis aries) [ 99.32
d1n71a_180 Aminoglycoside 6'-N-acetyltransferase {Enterococcu 99.31
d1ygha_164 Catalytic domain of GCN5 histone acetyltransferase 99.3
d2i6ca1160 Putative acetyltransferase PA4794 {Pseudomonas aer 99.3
d1z4ra1162 Catalytic domain of GCN5 histone acetyltransferase 99.29
d1wwza1157 Hypothetical protein PH1933 {Pyrococcus horikoshii 99.27
d2fiwa1156 Probable N-acetyltransferase RPA1999 {Rhodopseudom 99.25
d2ae6a1161 Putative acetyltransferase EF0244 {Enterococcus fa 99.24
d1y9wa1140 Probable acetyltransferase BC2806 {Bacillus cereus 99.24
d1xeba_149 Hypothetical protein PA0115 {Pseudomonas aeruginos 99.23
d2fl4a1146 Probable spermine/spermidine acetyltransferase EF1 99.23
d1z4ea1150 Transcriptional regulator BH1968 {Bacillus halodur 99.22
d1qsma_150 Histone acetyltransferase HPA2 {Baker's yeast (Sac 99.22
d1i12a_157 Glucosamine-phosphate N-acetyltransferase GNA1 {Ba 99.21
d2euia1153 Probable acetyltransferase PA4026 {Pseudomonas aer 99.19
d1q2ya_140 Probable acetyltransferase YjcF {Bacillus subtilis 99.16
d1y7ra1133 Hypothetical protein SA2161 {Staphylococcus aureus 99.15
d2cy2a1174 Probable acetyltransferase TTHA1209 {Thermus therm 99.15
d2b5ga1167 Diamine acetyltransferase 1 {Human (Homo sapiens) 99.14
d1yr0a1163 Phosphinothricin acetyltransferase {Agrobacterium 99.14
d1ghea_170 Tabtoxin resistance protein {Pseudomonas syringae 99.13
d1yx0a1151 Hypothetical protein YsnE {Bacillus subtilis [TaxI 99.13
d1vhsa_165 Putative phosphinothricin acetyltransferase YwnH { 99.12
d2gana1182 Hypothetical protein PH0736 {Pyrococcus horikoshii 99.09
d1yvoa1169 Hypothetical protein PA4866 {Pseudomonas aeruginos 99.07
d1mk4a_157 Hypothetical protein YqiY {Bacillus subtilis [TaxI 99.06
d2beia1167 Diamine acetyltransferase 2 {Human (Homo sapiens) 99.06
d2ge3a1164 Probable acetyltransferase Atu2290 {Agrobacterium 99.03
d1u6ma_189 Putative acetyltransferase EF0945 {Enterococcus fa 98.97
d2g3aa1137 Probable acetyltransferase Atu2258 {Agrobacterium 98.95
d2jdca1145 Probable acetyltransferase YitI {Bacillus lichenif 98.94
d1r57a_102 Hypothetical protein SA2309 {Staphylococcus aureus 98.92
d1m4ia_181 Aminoglycoside 2'-N-acetyltransferase {Mycobacteri 98.89
d1yvka1152 Hypothetical protein YvbK (BSu33890) {Bacillus sub 98.87
d1y9ka1152 IAA acetyltransferase {Bacillus cereus [TaxId: 139 98.84
d1p0ha_ 308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.83
d2ozga2 283 Putative acetyltransferase Ava4977 {Anabaena varia 98.81
d2hv2a2 285 Hypothetical protein EF1021 {Enterococcus faecalis 98.79
d2i00a2 291 Putative acetyltransferase EF2353 {Enterococcus fa 98.64
d1p0ha_308 Mycothiol synthase MshD {Mycobacterium tuberculosi 98.61
d1nsla_180 Probable acetyltransferase YdaF {Bacillus subtilis 98.54
d1s7ka1174 L7/L12-Ribosomal-protein-serine acetyltransferase 98.39
d1yrea1183 Hypothetical protein PA3270 {Pseudomonas aeruginos 98.36
d2fcka1178 Putative ribosomal-protein-serine acetyltransferas 98.34
d1sqha_297 Hypothetical protein cg14615-pa {Fruit fly (Drosop 98.21
d1yk3a1198 Hypothetical protein Rv1347c/MT1389 {Mycobacterium 98.21
d1ro5a_197 Autoinducer synthesis protein LasI {Pseudomonas ae 97.73
d2fsra1164 Probable acetyltranferase Atu2435 {Agrobacterium t 97.64
d1rxta1141 N-myristoyl transferase, NMT {Human (Homo sapiens) 97.39
d1xmta_95 Hypothetical protein AT1g77540 {Thale cress (Arabi 97.38
d1boba_315 Histone acetyltransferase HAT1 {Baker's yeast (Sac 97.13
d1iyka1165 N-myristoyl transferase, NMT {Yeast (Candida albic 97.11
d1iica1185 N-myristoyl transferase, NMT {Baker's yeast (Sacch 97.09
d2giva1 271 Probable histone acetyltransferase MYST1 {Human (H 96.68
d2ozua1 270 Histone acetyltransferase MYST3 {Human (Homo sapie 96.6
d1fy7a_ 273 Histone acetyltransferase ESA1 {Baker's yeast (Sac 96.54
d1ylea1 338 Arginine N-succinyltransferase, alpha chain, AstA 95.43
d1kzfa_210 Acyl-homoserinelactone synthase EsaI {Pantoea stew 94.6
d1lrza3182 Methicillin resistance protein FemA {Staphylococcu 93.21
d1ne9a2171 Peptidyltransferase FemX {Weissella viridescens [T 92.08
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 92.0
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 91.29
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 89.66
d2cota238 Zinc finger and SCAN domain-containing protein 16, 89.59
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 89.4
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 89.32
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 88.2
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 88.18
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 87.78
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 87.73
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 86.13
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 85.82
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 83.72
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 83.39
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 81.92
d2ozga2283 Putative acetyltransferase Ava4977 {Anabaena varia 80.25
>d1jj2y_ g.41.8.1 (Y:) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Zn-binding ribosomal proteins
family: Ribosomal protein L37ae
domain: Ribosomal protein L37ae
species: Archaeon Haloarcula marismortui [TaxId: 2238]

Probab=99.74  E-value=2e-19  Score=112.78  Aligned_cols=35  Identities=40%  Similarity=0.847  Sum_probs=34.1

Q ss_pred             ccccccccchhHhHhHHhhhhhcccccccCCCCcc
Q psy838           11 TGKYGTRYGASLRKMVKKMEITQHAKYTCSFCGKE   45 (152)
Q Consensus        11 ~~~~g~ryg~~~rk~~~~~~~~~~~~~~c~~c~~~   45 (152)
                      +||||+|||++|||+|++||++||++|+|||||+.
T Consensus         2 TGrfG~RYG~slRk~v~kie~~q~~ky~Cp~Cgk~   36 (73)
T d1jj2y_           2 TGRFGPRYGLKIRVRVADVEIKHKKKHKCPVCGFK   36 (73)
T ss_dssp             GGGGTTCSCHHHHHHHHHHHHHHHSCBCCSSSCCS
T ss_pred             CCccccccCHHHHHHHHHHHHHhcCCccCCCCCCC
Confidence            69999999999999999999999999999999987
>d1vqoz1 g.41.8.1 (Z:10-82) Ribosomal protein L37ae {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1tiqa_ d.108.1.1 (A:) Protease synthase and sporulation negative regulatory protein PaiA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2aj6a1 d.108.1.1 (A:1-118) Hypothetical protein MW0638 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1bo4a_ d.108.1.1 (A:) Aminoglycoside 3-N-acetyltransferase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1vkca_ d.108.1.1 (A:) Putative acetyltransferase PF0028 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1s3za_ d.108.1.1 (A:) Aminoglycoside N-acetyltransferase AAC(6')-IY {Salmonella enteritidis [TaxId: 149539]} Back     information, alignment and structure
>d1ufha_ d.108.1.1 (A:) Putative acetyltransferase YycN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qsra_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Tetrahymena thermophila [TaxId: 5911]} Back     information, alignment and structure
>d2atra1 d.108.1.1 (A:1-137) Probable acetyltransferase SP0256 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fiaa1 d.108.1.1 (A:1-157) Probable acetyltransferase EF1919 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cjwa_ d.108.1.1 (A:) Serotonin N-acetyltranferase {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1n71a_ d.108.1.1 (A:) Aminoglycoside 6'-N-acetyltransferase {Enterococcus faecium [TaxId: 1352]} Back     information, alignment and structure
>d1ygha_ d.108.1.1 (A:) Catalytic domain of GCN5 histone acetyltransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i6ca1 d.108.1.1 (A:1001-1160) Putative acetyltransferase PA4794 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1z4ra1 d.108.1.1 (A:497-658) Catalytic domain of GCN5 histone acetyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwza1 d.108.1.1 (A:1-157) Hypothetical protein PH1933 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fiwa1 d.108.1.1 (A:2-157) Probable N-acetyltransferase RPA1999 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d2ae6a1 d.108.1.1 (A:1-161) Putative acetyltransferase EF0244 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y9wa1 d.108.1.1 (A:1-140) Probable acetyltransferase BC2806 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1xeba_ d.108.1.1 (A:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fl4a1 d.108.1.1 (A:1-146) Probable spermine/spermidine acetyltransferase EF1086 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1z4ea1 d.108.1.1 (A:4-153) Transcriptional regulator BH1968 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1qsma_ d.108.1.1 (A:) Histone acetyltransferase HPA2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i12a_ d.108.1.1 (A:) Glucosamine-phosphate N-acetyltransferase GNA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q2ya_ d.108.1.1 (A:) Probable acetyltransferase YjcF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y7ra1 d.108.1.1 (A:1-133) Hypothetical protein SA2161 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d2cy2a1 d.108.1.1 (A:1-174) Probable acetyltransferase TTHA1209 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b5ga1 d.108.1.1 (A:3-169) Diamine acetyltransferase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yr0a1 d.108.1.1 (A:4-166) Phosphinothricin acetyltransferase {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1ghea_ d.108.1.1 (A:) Tabtoxin resistance protein {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1yx0a1 d.108.1.1 (A:1-151) Hypothetical protein YsnE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhsa_ d.108.1.1 (A:) Putative phosphinothricin acetyltransferase YwnH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2gana1 d.108.1.1 (A:1-182) Hypothetical protein PH0736 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yvoa1 d.108.1.1 (A:4-172) Hypothetical protein PA4866 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mk4a_ d.108.1.1 (A:) Hypothetical protein YqiY {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2beia1 d.108.1.1 (A:3-169) Diamine acetyltransferase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ge3a1 d.108.1.1 (A:6-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1u6ma_ d.108.1.1 (A:) Putative acetyltransferase EF0945 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2g3aa1 d.108.1.1 (A:1-137) Probable acetyltransferase Atu2258 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2jdca1 d.108.1.1 (A:2-146) Probable acetyltransferase YitI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1r57a_ d.108.1.1 (A:) Hypothetical protein SA2309 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1m4ia_ d.108.1.1 (A:) Aminoglycoside 2'-N-acetyltransferase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yvka1 d.108.1.1 (A:5-156) Hypothetical protein YvbK (BSu33890) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y9ka1 d.108.1.1 (A:1-152) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2hv2a2 d.108.1.10 (A:2-286) Hypothetical protein EF1021 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2i00a2 d.108.1.10 (A:10-300) Putative acetyltransferase EF2353 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1p0ha_ d.108.1.1 (A:) Mycothiol synthase MshD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nsla_ d.108.1.1 (A:) Probable acetyltransferase YdaF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1s7ka1 d.108.1.1 (A:3-176) L7/L12-Ribosomal-protein-serine acetyltransferase RimL {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1yrea1 d.108.1.1 (A:11-193) Hypothetical protein PA3270 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fcka1 d.108.1.1 (A:1-178) Putative ribosomal-protein-serine acetyltransferase VC1889 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1sqha_ d.108.1.5 (A:) Hypothetical protein cg14615-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1yk3a1 d.108.1.1 (A:10-207) Hypothetical protein Rv1347c/MT1389 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ro5a_ d.108.1.3 (A:) Autoinducer synthesis protein LasI {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2fsra1 d.108.1.1 (A:4-167) Probable acetyltranferase Atu2435 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1rxta1 d.108.1.2 (A:78-218) N-myristoyl transferase, NMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xmta_ d.108.1.1 (A:) Hypothetical protein AT1g77540 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1boba_ d.108.1.1 (A:) Histone acetyltransferase HAT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iyka1 d.108.1.2 (A:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1iica1 d.108.1.2 (A:34-218) N-myristoyl transferase, NMT {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2giva1 d.108.1.1 (A:4-274) Probable histone acetyltransferase MYST1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozua1 d.108.1.1 (A:507-776) Histone acetyltransferase MYST3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fy7a_ d.108.1.1 (A:) Histone acetyltransferase ESA1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ylea1 d.108.1.8 (A:1-338) Arginine N-succinyltransferase, alpha chain, AstA {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1kzfa_ d.108.1.3 (A:) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]} Back     information, alignment and structure
>d1lrza3 d.108.1.4 (A:166-244,A:310-412) Methicillin resistance protein FemA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ne9a2 d.108.1.4 (A:165-335) Peptidyltransferase FemX {Weissella viridescens [TaxId: 1629]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozga2 d.108.1.10 (A:8-290) Putative acetyltransferase Ava4977 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure