Diaphorina citri psyllid: psy8393


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MNCLIIGLGQTQKGVVIIQKSYALKQMMNFNEVQSKLSSSEPVWKILIFDRCGQDIISPVLSKNDLRELGVTLFLYSAEVLDEEYSALCLMCLRMNCY
ccCEEECcccccHHHHHHHHHHHHHHHHcccccccccccccccEEEEEECcccccEECccccHHHHHHccEEEEEEcccHHHHccccEEEEEEEcccc
**CLIIGLGQTQKGVVIIQKSYALKQMMNFNEVQSKLSSSEPVWKILIFDRCGQDIISPVLSKNDLRELGVTLFLYSAEVLDEEYSALCLMCLRMNCY
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNCLIIGLGQTQKGVVIIQKSYALKQMMNFNEVQSKLSSSEPVWKILIFDRCGQDIISPVLSKNDLRELGVTLFLYSAEVLDEEYSALCLMCLRMNCY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Sec1 family domain-containing protein 1 Plays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with COG4. Involved in vesicular transport between the endoplasmic reticulum and the Golgi.confidentQ8BRF7
Protein sly1 homolog Non-vital for development.confidentQ24179
Sec1 family domain-containing protein 1 Plays a role in SNARE-pin assembly and Golgi-to-ER retrograde transport via its interaction with COG4. Involved in vesicular transport between the endoplasmic reticulum and the Golgi.confidentQ8WVM8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005798 [CC]Golgi-associated vesicleprobableGO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031982
GO:0044707 [BP]single-multicellular organism processprobableGO:0032501, GO:0008150, GO:0044699
GO:0006892 [BP]post-Golgi vesicle-mediated transportprobableGO:0009987, GO:0016192, GO:0046907, GO:0048193, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0031201 [CC]SNARE complexprobableGO:0043234, GO:0005737, GO:0032991, GO:0016020, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425
GO:0017119 [CC]Golgi transport complexprobableGO:0043234, GO:0005794, GO:0032991, GO:0005575, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005801 [CC]cis-Golgi networkprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Y9J, chain A
Confidence level:very confident
Coverage over the Query: 14-86
View the alignment between query and template
View the model in PyMOL